DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15525 and ccdc12

DIOPT Version :9

Sequence 1:NP_651757.1 Gene:CG15525 / 43556 FlyBaseID:FBgn0039732 Length:161 Species:Drosophila melanogaster
Sequence 2:NP_001096533.1 Gene:ccdc12 / 100125177 XenbaseID:XB-GENE-970156 Length:157 Species:Xenopus tropicalis


Alignment Length:159 Identity:71/159 - (44%)
Similarity:100/159 - (62%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VGKLTQESLKRKERLQKLREQVQNKGGD------AAESIEKLPKPVFRSYKPQNETTDGEILAQE 67
            ||:|..|:|:|||||::||.:.|...|:      ..|..|...:...|:|.||::......:.|.
 Frog     5 VGRLEVEALRRKERLKELRNKRQKDEGEPENKMRVGEEEEPHRELKLRNYTPQDDDLKERQVPQA 69

  Fly    68 PTGNIESAVEDQLSLLQQPMVIDEIDITNLAPRKPDWDLKRDASKKLERLERRTQKAIAELIRER 132
            ...::|..|::||...:...:|:|:|:.||||||||||||||.:||||:||:|||:|||||||||
 Frog    70 KPISVEEKVKEQLEAAKPEPIIEEVDLANLAPRKPDWDLKRDVAKKLEKLEKRTQRAIAELIRER 134

  Fly   133 LKLNQMEDISQAVNVATAHAGESVQEDYD 161
            || .|.:|::.||       |.:.|||.|
 Frog   135 LK-GQEDDLATAV-------GSANQEDED 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15525NP_651757.1 cwf18 11..132 CDD:285510 56/126 (44%)
ccdc12NP_001096533.1 cwf18 8..135 CDD:369809 57/126 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 109 1.000 Domainoid score I6312
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41751
Inparanoid 1 1.050 122 1.000 Inparanoid score I4600
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1604272at2759
OrthoFinder 1 1.000 - - FOG0005517
OrthoInspector 1 1.000 - - oto105508
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R274
SonicParanoid 1 1.000 - - X3935
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.