DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sas-6 and SASS6

DIOPT Version :9

Sequence 1:NP_651756.1 Gene:Sas-6 / 43555 FlyBaseID:FBgn0039731 Length:472 Species:Drosophila melanogaster
Sequence 2:NP_919268.1 Gene:SASS6 / 163786 HGNCID:25403 Length:657 Species:Homo sapiens


Alignment Length:456 Identity:115/456 - (25%)
Similarity:196/456 - (42%) Gaps:66/456 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LQLRLTEKSDQRRMYITTVDSASFQDLKQDQSLNVSFSGFIDNVVRMLKDC------QSGKLELH 116
            |.:|||:.:|...:|...:....||.||..|.|.|.|..|....:.:|:.|      :..:..|.
Human    44 LVIRLTDDTDPFFLYNLVISEEDFQSLKFQQGLLVDFLAFPQKFIDLLQQCTQEHAKEIPRFLLQ 108

  Fly   117 LTTRDQNLSSGREVHDYYLQFVEIRSFKNLVHLSLPCRSAPLNTVLF--YINSMLEASHKKQYIL 179
            |.:....|.:.    ..:|..||...||:|.||||  :..|.|.|..  ::...|:.|.:::..|
Human   109 LVSPAAILDNS----PAFLNVVETNPFKHLTHLSL--KLLPGNDVEIKKFLAGCLKCSKEEKLSL 167

  Fly   180 EQSMQQMQAEINAQRAHAERLTTENTNIREALAENTRILEEKHAAEVH-----------QYQEKL 233
            .||:.....:::..|........|...:|...|.:|..|..||:.|:.           |||:: 
Human   168 MQSLDDATKQLDFTRKTLAEKKQELDKLRNEWASHTAALTNKHSQELTNEKEKALQAQVQYQQQ- 231

  Fly   234 SKINEQRSNELE----RNRRAISGFQAQLDKASLEKAELK----SAQEQAEKRCQTLSEELSCCK 290
               :||:..:||    :|...:....::|:.|:.:..|.|    |...:.:.:...:.|||...|
Human   232 ---HEQQKKDLEILHQQNIHQLQNRLSELEAANKDLTERKYKGDSTIRELKAKLSGVEEELQRTK 293

  Fly   291 ARVCTLKEQNDKLHGDVANIRKHERKLEYKIEDLKQH----------------TVELQEHIQKGN 339
            ..|.:|:.:|..|..:.....||..:|:.|:..|:|.                |::.|:.:.:.|
Human   294 QEVLSLRRENSTLDVECHEKEKHVNQLQTKVAVLEQEIKDKDQLVLRTKEAFDTIQEQKVVLEEN 358

  Fly   340 KEKANI-AAELEAEKKILHTKRQALEMASEEISKANQIIVKQSQELLNLKKTIAWRTEVALQQEK 403
            .||..: ..:|||..|.|          |.|:.|||:||.|...:|..|...:..:..|.:||||
Human   359 GEKNQVQLGKLEATIKSL----------SAELLKANEIIKKLQGDLKTLMGKLKLKNTVTIQQEK 413

  Fly   404 AVQAKESLLSLRENELREARITIEKLREEIPQQLQSMRNFAQGLEQKYSKQILILKERLAIPTGK 468
            .:..||..|...:.||::...::....:|:.:..:.:....:.||:  |||:|...|:|.....|
Human   414 LLAEKEEKLQKEQKELQDVGQSLRIKEQEVCKLQEQLEATVKKLEE--SKQLLKNNEKLITWLNK 476

  Fly   469 E 469
            |
Human   477 E 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sas-6NP_651756.1 SAS-6_N 59..152 CDD:293139 28/98 (29%)
SASS6NP_919268.1 SAS-6_N 46..140 CDD:293139 29/99 (29%)
Lebercilin 237..397 CDD:292252 41/169 (24%)
NBP1 <249..>357 CDD:285709 21/107 (20%)
TOP4c <360..480 CDD:238111 38/130 (29%)
CASP_C 445..>545 CDD:285395 10/35 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 487..510
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 615..657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CMEI
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 110 1.000 Inparanoid score I4898
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56642
OrthoDB 1 1.010 - - D345225at2759
OrthoFinder 1 1.000 - - FOG0006147
OrthoInspector 1 1.000 - - oto89379
orthoMCL 1 0.900 - - OOG6_104016
Panther 1 1.100 - - LDO PTHR44281
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4745
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.870

Return to query results.
Submit another query.