DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and RBP47C

DIOPT Version :10

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_175180.1 Gene:RBP47C / 841157 AraportID:AT1G47490 Length:432 Species:Arabidopsis thaliana


Alignment Length:162 Identity:43/162 - (26%)
Similarity:64/162 - (39%) Gaps:46/162 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTTAKVFVGSL-PRCKPEELRRLFTNYGSV--VECDVMNRCAFVHLENTDMAEAAIAALNGTIF 62
            ||||  :|||.| .....|:|::.|..:|.:  |:..|...|.||...|...||.|:..||||:.
plant   302 MNTT--IFVGGLDSSVTDEDLKQPFNEFGEIVSVKIPVGKGCGFVQFVNRPNAEEALEKLNGTVI 364

  Fly    63 KGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRF 127
            ..|.:.:..||                 ||           |:|:|.:...|  :......||:|
plant   365 GKQTVRLSWGR-----------------NP-----------ANKQPRDKYGN--QWVDPYYGGQF 399

  Fly   128 SNEGPRSSNSSAAKFGPVRNESNYRQQRSAPY 159
            .|           .:|.:..:.:.|...:|||
plant   400 YN-----------GYGYMVPQPDPRMYPAAPY 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM_SF 6..70 CDD:473069 22/66 (33%)
PABP-1234 <18..173 CDD:130689 35/144 (24%)
RBP47CNP_175180.1 RRM1_SECp43_like 102..184 CDD:409780
RRM2_SECp43_like 196..275 CDD:409781
RRM3_NGR1_NAM8_like 303..374 CDD:409782 25/72 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.