DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and UBP1B

DIOPT Version :10

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_564018.1 Gene:UBP1B / 838309 AraportID:AT1G17370 Length:419 Species:Arabidopsis thaliana


Alignment Length:62 Identity:19/62 - (30%)
Similarity:26/62 - (41%) Gaps:1/62 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 LQKKHMLLPKNGQSGNTAPPTTLINELNYEDVV-LTLTFKESIEGTVRELTLPIGVKCDRCS 204
            ||||.:...|.....||......:|..||..|. |.....|:...|:.|:...|.|.|.:|:
plant    16 LQKKVLSKAKPVLVKNTKGMMINLNFPNYIKVADLGCATGENTFLTMAEIVNTINVLCQQCN 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM_SF 6..70 CDD:473069
PABP-1234 <18..173 CDD:130689 9/28 (32%)
UBP1BNP_564018.1 RRM1_PUB1 56..126 CDD:410026 7/22 (32%)
RRM2_PUB1 138..217 CDD:410031
RRM3_PUB1 260..336 CDD:410033
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.