DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and RS40

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001190837.1 Gene:RS40 / 828654 AraportID:AT4G25500 Length:350 Species:Arabidopsis thaliana


Alignment Length:400 Identity:101/400 - (25%)
Similarity:149/400 - (37%) Gaps:86/400 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVGSLP-RCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIF--KGQPIV 68
            ||.|:.. ..:..:|.|||..||.|...|:....|||::|:...||.||.||:...|  ||:.:.
plant     4 VFCGNFEYDAREGDLERLFRKYGKVERVDMKAGFAFVYMEDERDAEDAIRALDRFEFGRKGRRLR 68

  Fly    69 VEAGRPKYG----PGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRFSN 129
            ||..:.:.|    .|||||....|     .|||:              |.|..||..:      |
plant    69 VEWTKSERGGDKRSGGGSRRSSSS-----MRPSK--------------TLFVINFDAD------N 108

  Fly   130 EGPRSSNSSAAKFGPVRNES--------NYRQQRSAPYSKGPPNNESSNQGQGFRNKFAGGGKFG 186
            ...|........:|.:.|..        .|..|..|..:....|| |....:....::|  .|..
plant   109 TRTRDLEKHFEPYGKIVNVRIRRNFAFIQYEAQEDATRALDASNN-SKLMDKVISVEYA--VKDD 170

  Fly   187 GSAGNEGRFGSNRFQQRDNS------GPQPGRRNFKN-------SPTSGYRGGGNNSDFQGGSSS 238
            .:.||    |.:..::||.|      .|.|.:|...:       ||.:.||....:.|:  |...
plant   171 DARGN----GHSPERRRDRSPERRRRSPSPYKRERGSPDYGRGASPVAAYRKERTSPDY--GRRR 229

  Fly   239 SGGGGSVNQRAGGGGPGPSHVRQDRRGFALPVEHQQQQMGFGRFGNGPMNSGNRGTNGGNPPGGR 303
            |......::|      |.....:||||...| ..:::.....::...|.|...|.:...:|....
plant   230 SPSPYKKSRR------GSPEYGRDRRGNDSP-RRRERVASPTKYSRSPNNKRERMSPNHSPFKKE 287

  Fly   304 GFFNGGGGGFN--DRRDSSHETSSPQGGPSKRGGSGGRNHNQNGINAYHSEFPPLGSGGGGPGQR 366
            ...||.|...:  :||:.|.  |||:.|..:..||.||..:..|.:           |...|.|:
plant   288 SPRNGVGEVESPIERRERSR--SSPENGQVESPGSIGRRDSDGGYD-----------GAESPMQK 339

  Fly   367 NRFNGPRPGP 376
            :|  .||..|
plant   340 SR--SPRSPP 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 49/175 (28%)
RRM_SF 6..70 CDD:302621 24/65 (37%)
RS40NP_001190837.1 RRM1_AtRSp31_like 2..73 CDD:240680 26/68 (38%)
RRM_SF 98..167 CDD:388407 15/77 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.