DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and RS31

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_567120.1 Gene:RS31 / 825359 AraportID:AT3G61860 Length:264 Species:Arabidopsis thaliana


Alignment Length:288 Identity:69/288 - (23%)
Similarity:97/288 - (33%) Gaps:96/288 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVGSLP-RCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPIVVE 70
            ||||:.. ..:..:|.|||..||.|...|:.:..|||:.|:...||.||..|:..     |...|
plant     4 VFVGNFEYETRQSDLERLFDKYGRVDRVDMKSGYAFVYFEDERDAEDAIRKLDNF-----PFGYE 63

  Fly    71 AGRPKYGPGGGSRGQP-GSGDNPGR-RPSQ---------VQGGGADKRPH------ESNTNFKRN 118
            ..|.......|.||:| |....|.. :|::         ::....|...|      .:|...:||
plant    64 KRRLSVEWAKGERGRPRGDAKAPSNLKPTKTLFVINFDPIRTKEHDIEKHFEPYGKVTNVRIRRN 128

  Fly   119 FR------------------------------------EEVGGRFSNEGPRSSNSSAAKFGPVRN 147
            |.                                    :|...|.....||.|.|      ||  
plant   129 FSFVQFETQEDATKALEATQRSKILDRVVSVEYALKDDDERDDRNGGRSPRRSLS------PV-- 185

  Fly   148 ESNYRQQRSAPYSKGPPNNESSNQGQGFRNKFAGGGKFGGSAGNEGRFGSNRFQQRDNSGPQPGR 212
               ||::.|..|.:.|      :.|||.|           .:.:.||..|..:.:  ..||....
plant   186 ---YRRRPSPDYGRRP------SPGQGRR-----------PSPDYGRARSPEYDR--YKGPAAYE 228

  Fly   213 RNFKNSPTSGYRGGGNNSDFQGGSSSSG 240
            |  :.||..|.|    :||: |...|.|
plant   229 R--RRSPDYGRR----SSDY-GRQRSPG 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 50/214 (23%)
RRM_SF 6..70 CDD:302621 22/63 (35%)
RS31NP_567120.1 RRM_SF 2..73 CDD:418427 24/73 (33%)
RRM2_AtRSp31_like 94..163 CDD:409899 6/68 (9%)
PTZ00449 <138..209 CDD:185628 17/98 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.