DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and PHIP1

DIOPT Version :10

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_191094.1 Gene:PHIP1 / 824700 AraportID:AT3G55340 Length:597 Species:Arabidopsis thaliana


Alignment Length:81 Identity:21/81 - (25%)
Similarity:33/81 - (40%) Gaps:16/81 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LLVEVKHRTESVVDLNPSLYRDLQKKHMLLPKNGQSGNTAPPTTLINELNYEDVVLTLTFKESIE 186
            ||:.:.|:.|..:..|.:..|:. ..:...|:..|  |.:||.. ||..|..|.:          
plant    10 LLIAIAHKAEPFISENFTECREF-FYNQSFPQGFQ--NISPPHH-INHPNLPDGI---------- 60

  Fly   187 GTVRELTLPIGVKCDR 202
             ..:|||.|..: |.|
plant    61 -KAKELTSPAYI-CQR 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM_SF 6..70 CDD:473069
PABP-1234 <18..173 CDD:130689 14/50 (28%)
PHIP1NP_191094.1 RRM1_PHIP1 163..234 CDD:409714
RRM2_PHIP1 263..334 CDD:409715
PTZ00368 393..592 CDD:173561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.