DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and ralyl

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_012820330.1 Gene:ralyl / 779659 XenbaseID:XB-GENE-5767075 Length:333 Species:Xenopus tropicalis


Alignment Length:162 Identity:46/162 - (28%)
Similarity:66/162 - (40%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKVFVGSLPR--CKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            ::||:|:|..  .|..::..:|..||.:|.|.|....|||...:...|.||:...|..|..|||:
 Frog    21 SRVFIGNLNTGIVKKADIEAIFAKYGKIVGCSVHKGYAFVQYISERHARAAVTGENSRIIGGQPL 85

  Fly    68 VVE-AGRPK-YGPGGGSRGQPGS----------------------GDNPGRRPSQVQGGGADKRP 108
            .:. ||.|| |.|..|:: :|.|                      ....||.|...:.....|||
 Frog    86 DINMAGEPKPYRPKLGTK-RPLSTLYSAYDFDYDYYRDDFYNRLFDYGHGRVPPPPRAAIPLKRP 149

  Fly   109 HESNTNFKRN---FREEVGGRFSNEGPRSSNS 137
            ..|....:|.   |..:.|.|.::.|..||.|
 Frog   150 RMSVPTTRRGKGVFSLKGGSRSASGGSSSSGS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 46/162 (28%)
RRM_SF 6..70 CDD:302621 22/65 (34%)
ralylXP_012820330.1 RRM_SF 15..97 CDD:418427 26/75 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.