DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and Rbm31y

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_083246.1 Gene:Rbm31y / 74484 MGIID:1921734 Length:565 Species:Mus musculus


Alignment Length:443 Identity:91/443 - (20%)
Similarity:132/443 - (29%) Gaps:161/443 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFVGSL-PRCKPEELRRLFTNYGSV--VE---C-DVMNRCAFVHLENTDMAEAAIAALNGTIFK 63
            |:|||.| ||...|::|..|..:|.:  :|   | |...|.||..::..|.........|...|.
Mouse   119 KIFVGGLNPRLSEEKIRAYFGTFGQIEAIELPLCSDTRERRAFGFIKYMDENSVRKVLENRYHFI 183

  Fly    64 GQP-IVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADK-RPHESNTNFKRNFREEVGGR 126
            |.. ..|:...||              :||.|:.|:.:....|: |........:.|:|   || 
Mouse   184 GSSRCEVKMAYPK--------------ENPARQLSKRKAIAKDRTRKSVPAVELENNWR---GG- 230

  Fly   127 FSNEGPRS----SNSSAAKFGPVRNESNYRQQRSAPYSKGPPNNESSNQGQGFRNKFAGGGKFGG 187
                |..|    :||.|       .|:|....|:..|:....::.:.....|||:          
Mouse   231 ----GSPSFHIMANSEA-------QEANQDAHRAGSYTSRANSDVTLTNACGFRD---------- 274

  Fly   188 SAGNEGRFGSNRFQQRDNSGPQPGRRNFKNSPT-----SGYRGGGNNSDFQGGSSSSG------- 240
             :.|.....||.|.  .||.......|...|.|     |.|....|.:.|.....:.|       
Mouse   275 -SPNAFHVNSNVFV--TNSTTFIASSNALRSSTNTVGVSHYTLDANPNTFLASQYTLGTISNTLR 336

  Fly   241 ----------GGGSVNQRAGGGGPGPSHVRQ-----DRRGF---ALPVEHQQQQMGFGRFGNGPM 287
                      ....|:|.|....|....:.|     |:..|   ..|:.......|.|::.:|..
Mouse   337 TSQYTLGTYPNALGVSQYALAAYPNTFGINQYPLEADQNAFWTNQYPLGTYSDAFGIGQYASGTS 401

  Fly   288 NSG------NRGTN---------------------------------------GGNPPGGRGFFN 307
            .:|      :.|||                                       |.||        
Mouse   402 PNGFGVSQYSLGTNADTFRTNCFALVANPYNIWTNHYVLATNPNVFRTSQYVLGENP-------- 458

  Fly   308 GGGGGFNDRRDSSHETSSPQG--GPSK--------------RGGS-GGRNHNQ 343
                  |....|.:...:.|.  ||::              |||| ||.|.:|
Mouse   459 ------NAFESSQYSVGATQNNFGPNQHNFGANGNFCGTVGRGGSTGGLNFSQ 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 43/174 (25%)
RRM_SF 6..70 CDD:302621 21/71 (30%)
Rbm31yNP_083246.1 RRM_SF 35..108 CDD:302621
RRM_SF 119..193 CDD:302621 22/73 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.