DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and BOLL

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001271290.1 Gene:BOLL / 66037 HGNCID:14273 Length:339 Species:Homo sapiens


Alignment Length:104 Identity:25/104 - (24%)
Similarity:43/104 - (41%) Gaps:23/104 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFVGSLP-RCKPEELRRLFTNYGSVVECDVMNRCA-------FVHLENTDMAEAAIAALNGTIF 62
            ::|||.:. :....:||:.|:.||||.|..::|..|       ||..|..:.|:..:.......:
Human    40 RIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNY 104

  Fly    63 KGQPIVV-------EAGRPKYG--PGGG------SRGQP 86
            |.:.:.:       :.|.|:..  |..|      |.|.|
Human   105 KDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 25/104 (24%)
RRM_SF 6..70 CDD:302621 18/78 (23%)
BOLLNP_001271290.1 RRM_BOULE 37..117 CDD:241117 18/76 (24%)
RRM <38..>119 CDD:223796 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.