DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and hnrnpd

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:292 Identity:68/292 - (23%)
Similarity:105/292 - (35%) Gaps:73/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFVGSLP-RCKPEELRRLFTNYGSVVECDV--------MNRCAFVHLENTDMAEAAIA----AL 57
            |:|||.|. ....::|:..||.:|.||:|.:        .....||..:..:..|..|.    .|
Zfish    55 KMFVGGLSWDTTKKDLKDYFTKFGEVVDCTLKLDPLTGRSRGFGFVLFKEAESVEKVITQKEHKL 119

  Fly    58 NGTIF---KGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGG-GADKRPHESNTNFKRN 118
            ||.:.   |.:.:..:....|...||.|   |.:.:...|......|. .:.:.|.|:.||.:|.
Zfish   120 NGKVIDPKKAKAMKTKEPVKKIFVGGLS---PDTPEEKIREYFDAYGEVESIELPMENKTNKRRG 181

  Fly   119 F------REEVGGRFSNEGPRSSNSSAAKFGPVRNESNYRQQR---------SAPYSKGPPNNES 168
            |      .||...:...:...:...|..:.....::..|:||:         |....:|.||   
Zfish   182 FCFITFKEEEPVKKIMEKMYHNIGLSKCEVKVAMSKEQYQQQQQWGGRGGYTSRGRGRGGPN--- 243

  Fly   169 SNQGQGFRNKFAGGGKFGGSAGNEGRFGSNRFQQRDNSGPQPGRRNFKNSPTSGYRGGGNNSDFQ 233
            .|..||:.|.:..|      .||.|.:|.|                     ..|| ||....|:.
Zfish   244 QNWNQGYGNYWNQG------YGNYGNYGYN---------------------NQGY-GGYGGYDYS 280

  Fly   234 GGSSSSGGGGSVNQRAGGGGPGPSHVRQDRRG 265
            |.::..|.|...||::|.|       :..|||
Zfish   281 GYNNYYGYGDYSNQQSGYG-------KSQRRG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 43/193 (22%)
RRM_SF 6..70 CDD:302621 20/79 (25%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369
RRM1_hnRNPD_like 56..129 CDD:241019 18/72 (25%)
RRM2_hnRNPD 140..214 CDD:241027 16/76 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.