DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and hnrnpc

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_012815605.1 Gene:hnrnpc / 448664 XenbaseID:XB-GENE-489141 Length:343 Species:Xenopus tropicalis


Alignment Length:206 Identity:45/206 - (21%)
Similarity:73/206 - (35%) Gaps:67/206 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTTAKVFVGSLPR--CKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFK 63
            ||  ::||:|:|..  .|..::..:|:.||.:|.|.|....|||...|...|..|:|..:|.:..
 Frog    75 MN--SRVFIGNLNTLVVKKADVEAIFSKYGKIVGCSVHKGYAFVQYSNERNARTAVAGEDGRMIA 137

  Fly    64 GQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRFS 128
            ||.:.:..                               .|:.:.:.|.|..||:..:..|..|.
 Frog   138 GQVMDINL-------------------------------AAEPKANRSKTGVKRSAADMYGSSFD 171

  Fly   129 NEGPRSSNSSAAKFGPVRNESNYRQQRSAPYSKGPP--------------NNESSNQGQ-GFRNK 178
            .|              ...:.:|....||.....||              :..:|.:|: ||.:|
 Frog   172 LE--------------YDFQRDYYDSYSATRVPPPPPIARAVVPSKRQRVSGNASRRGKSGFNSK 222

  Fly   179 FAGGGKFGGSA 189
               .|:.|||:
 Frog   223 ---SGQRGGSS 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 34/179 (19%)
RRM_SF 6..70 CDD:302621 21/65 (32%)
hnrnpcXP_012815605.1 RRM_hnRNPC 76..146 CDD:241047 22/102 (22%)
APG6_N <229..322 CDD:375248 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.