DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and trv

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:335 Identity:71/335 - (21%)
Similarity:98/335 - (29%) Gaps:116/335 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVGSL-PRCKPEELRRLFTNYGSVVECDVM--------NRCAFVHLENTDMAEAAIAALNGTIF 62
            :|||.| ...:.::||..||.:|.:.:|.|:        ....||.......||:||.|:||...
  Fly   314 IFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGFVSFIKKSEAESAITAMNGQWL 378

  Fly    63 KGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFK----------- 116
                              |||              .::...|.::|..|..|.|           
  Fly   379 ------------------GSR--------------SIRTNWATRKPPASKENIKPLTFDEVYNQS 411

  Fly   117 --RNFREEVGG---------------------------RFSNEG---PRSSNSSAAKFG--PVRN 147
              .|....|||                           .|.::|   .|.|...||...  .|.|
  Fly   412 SPSNCTVYVGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDKGYAFVRFSTKEAATHAIVGVHN 476

  Fly   148 ESNYRQQRSAPYSK--GPPNNESSNQGQGFRNKFAGGGKFG---GSAGNEGRFGSNRFQQRDNSG 207
            .....|.....:.|  |.|||..:...|...:..|....|.   |:|.....:|    ||...:|
  Fly   477 TEINAQPVKCSWGKESGDPNNAQTIATQALNSAAAAAAGFPYGVGAAAAAAAYG----QQLAATG 537

  Fly   208 PQPGRRNFKNSPTSGYRGGGNNSDFQGGSSSSGGGGSVNQRAGGGGPGPSHVRQDRRG--FALPV 270
                   ...|||..|            .:||....:|...|.......:...|..:|  |....
  Fly   538 -------CWYSPTPTY------------PASSATAAAVTPAAASAAAVQNQFLQGIQGYHFGQYG 583

  Fly   271 EHQQQQMGFG 280
            .:||..||.|
  Fly   584 GYQQGYMGMG 593

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 46/216 (21%)
RRM_SF 6..70 CDD:302621 20/71 (28%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 23/104 (22%)
RRM3_TIA1_like 416..491 CDD:240800 12/74 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.