DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and CG5213

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:128 Identity:34/128 - (26%)
Similarity:61/128 - (47%) Gaps:17/128 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NTTAKVFVGSLPRCKPE-ELRRLFTNYGSVVECDVM-----NR---CAFVHLENTDMAEAAIAAL 57
            :|::.::||:||....| ::|.||..||::|:.:::     ||   .||:..|....||.|...:
  Fly   124 STSSSLYVGNLPTYMDEKKVRELFATYGNIVDVNLLRHKFNNRSRGVAFLQFELVRDAEVAKYGM 188

  Fly    58 NGTIFKG--QPIVVE-AGRPKYGPGGGSRG-----QPGSGDNPGRRPSQVQGGGADKRPHESN 112
            :..:.:|  :|:.|: ..|.|.|....|.|     :..|...|.:|..:.......||..:|:
  Fly   189 DRYMIEGASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPPPYKRRERTNDHHVSKRSRDSD 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 33/126 (26%)
RRM_SF 6..70 CDD:302621 21/74 (28%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821
RRM 128..202 CDD:214636 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.