DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and hnrnpc

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_021335243.1 Gene:hnrnpc / 406352 ZFINID:ZDB-GENE-040426-2043 Length:393 Species:Danio rerio


Alignment Length:197 Identity:43/197 - (21%)
Similarity:65/197 - (32%) Gaps:61/197 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKVFVGSLPR--CKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            ::||:|:|..  ....::..:|:.||.:|.|.|....|||.......|..|:...:|.:..||.:
Zfish    26 SRVFIGNLNTMLVTKADVEAIFSKYGKIVGCSVHKGYAFVQFAQERNARTAVQGEDGRMVVGQVL 90

  Fly    68 VVE-AGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRFSNEG 131
            .|. ||.||                                ||.|.|. ||           :.|
Zfish    91 DVNLAGEPK--------------------------------PHRSKTT-KR-----------SAG 111

  Fly   132 PRSSNSSAAKFGPVRNESNYRQQRSAPY--------------SKGPPNNESSNQGQGFRNKFAGG 182
            ...|:||:.:.........|.:..|.|.              ||.|..:.|....:..::.||..
Zfish   112 DMYSSSSSFELDYDFQRDYYDRMYSYPSRVPAPPPLSRAVIPSKRPRVSTSGATSRRTKSSFATS 176

  Fly   183 GK 184
            .|
Zfish   177 SK 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 39/179 (22%)
RRM_SF 6..70 CDD:302621 18/65 (28%)
hnrnpcXP_021335243.1 RRM_hnRNPC 25..95 CDD:241047 19/68 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.