powered by:
Protein Alignment CG7903 and raly
DIOPT Version :9
Sequence 1: | NP_651755.2 |
Gene: | CG7903 / 43554 |
FlyBaseID: | FBgn0039730 |
Length: | 384 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_991173.1 |
Gene: | raly / 402903 |
ZFINID: | ZDB-GENE-041010-127 |
Length: | 273 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 25/74 - (33%) |
Similarity: | 38/74 - (51%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 AKVFVGSLPRC--KPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
::||:|:|... |..::..:|:.||.|:.|.|....|||...|...|..|:...||.:..||.:
Zfish 21 SRVFIGNLNTAVVKKSDVETIFSKYGRVLGCSVHKGYAFVQYANERHARGAVIGENGRVLAGQTL 85
Fly 68 VVE-AGRPK 75
.:. ||.||
Zfish 86 DINMAGEPK 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.