DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and raly

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_991173.1 Gene:raly / 402903 ZFINID:ZDB-GENE-041010-127 Length:273 Species:Danio rerio


Alignment Length:74 Identity:25/74 - (33%)
Similarity:38/74 - (51%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKVFVGSLPRC--KPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            ::||:|:|...  |..::..:|:.||.|:.|.|....|||...|...|..|:...||.:..||.:
Zfish    21 SRVFIGNLNTAVVKKSDVETIFSKYGRVLGCSVHKGYAFVQYANERHARGAVIGENGRVLAGQTL 85

  Fly    68 VVE-AGRPK 75
            .:. ||.||
Zfish    86 DINMAGEPK 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 25/74 (34%)
RRM_SF 6..70 CDD:302621 21/65 (32%)
ralyNP_991173.1 RRM_RALY 20..95 CDD:241048 25/74 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.