DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and cocoon

DIOPT Version :10

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_648764.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:132 Identity:30/132 - (22%)
Similarity:44/132 - (33%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFVGSLPRC----KPEELRRLFTNYGSVVECDVMNRC-AFVHLENTDMAEAAIAALNGTIFKGQ 65
            |||||   ||    :.::||..|:.:|.|::..:.... ||..:...|.....:......|.||.
  Fly   193 KVFVG---RCTEDIEADDLREYFSKFGEVIDVFIPKPFRAFSFVTFLDPYVPRVVCGEKHIIKGV 254

  Fly    66 PIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFK----RNFREEVGGR 126
            .:.|.....|.........|..:.:|                   .:.|||    .|||......
  Fly   255 SVHVSTADKKNVQNKNQLFQTNNYNN-------------------LDNNFKMQPANNFRMHPANN 300

  Fly   127 FS 128
            ||
  Fly   301 FS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM_SF 6..70 CDD:473069 18/68 (26%)
PABP-1234 <18..173 CDD:130689 23/116 (20%)
cocoonNP_648764.1 TDP43_N 3..78 CDD:465833
RRM1_TDP43 108..181 CDD:409760
RRM2_TDP43 193..262 CDD:409761 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.