DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and cocoon

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001261874.1 Gene:cocoon / 39665 FlyBaseID:FBgn0036496 Length:318 Species:Drosophila melanogaster


Alignment Length:132 Identity:30/132 - (22%)
Similarity:44/132 - (33%) Gaps:31/132 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFVGSLPRC----KPEELRRLFTNYGSVVECDVMNRC-AFVHLENTDMAEAAIAALNGTIFKGQ 65
            |||||   ||    :.::||..|:.:|.|::..:.... ||..:...|.....:......|.||.
  Fly   193 KVFVG---RCTEDIEADDLREYFSKFGEVIDVFIPKPFRAFSFVTFLDPYVPRVVCGEKHIIKGV 254

  Fly    66 PIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFK----RNFREEVGGR 126
            .:.|.....|.........|..:.:|                   .:.|||    .|||......
  Fly   255 SVHVSTADKKNVQNKNQLFQTNNYNN-------------------LDNNFKMQPANNFRMHPANN 300

  Fly   127 FS 128
            ||
  Fly   301 FS 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 30/132 (23%)
RRM_SF 6..70 CDD:302621 18/68 (26%)
cocoonNP_001261874.1 RRM1_TDP43 108..184 CDD:240767
RRM2_TDP43 193..262 CDD:240768 19/71 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439648
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.