DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and rbm4b

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_989204.1 Gene:rbm4b / 394812 XenbaseID:XB-GENE-494431 Length:338 Species:Xenopus tropicalis


Alignment Length:83 Identity:34/83 - (40%)
Similarity:48/83 - (57%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            :.|:.|.:| ..|..||||..|..||:|:|||::...||||:|.:..|..||..|:.|.|||:.:
 Frog    77 STKLHVSNLSTSCTSEELRAKFEEYGAVLECDIVKDYAFVHMERSAEALDAIKNLDNTEFKGKRM 141

  Fly    68 VVE--AGRPKYGPGGGSR 83
            .|:  ..|.:..||.|.|
 Frog   142 HVQLSTSRLRVTPGMGER 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 34/83 (41%)
RRM_SF 6..70 CDD:302621 28/64 (44%)
rbm4bNP_989204.1 RRM_SF 2..68 CDD:388407
RRM_SF 78..144 CDD:388407 28/65 (43%)
ZnF_C2HC 161..176 CDD:197667
COG5222 <162..>201 CDD:227547
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.