DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and rbm14

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_989050.1 Gene:rbm14 / 394647 XenbaseID:XB-GENE-491627 Length:468 Species:Xenopus tropicalis


Alignment Length:297 Identity:81/297 - (27%)
Similarity:117/297 - (39%) Gaps:45/297 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            |.|:|||:: ..|:..|:|::|..:|.|||||::...||||:.....:.|||.||||...||:.|
 Frog    83 TWKIFVGNVSSSCEVSEIRKMFEEHGRVVECDIVKDYAFVHMTRESESRAAIEALNGKEVKGKRI 147

  Fly    68 VVEAG---RPKYGPGGG-SRGQPGSGDNPGRRPSQVQGGGADKRPHES-------NTNFKRNFRE 121
            .||..   ||....|.. ||.:|...:.|..|.|.     ..:|..|:       .:|::|...|
 Frog   148 NVEMSHKVRPVAANGSSHSRRRPDDREAPQSRESY-----NHRRATEAAYASYALKSNYERYAPE 207

  Fly   122 EVGGRF----SNEGPRSSNSSAAKFGPVRNESNYRQQRSAPYSKGPPNNESSNQGQGFRNKFAGG 182
              ..|:    |...|.|....|....|:|.......|.:|..||             :|::.||.
 Frog   208 --SSRYDLYESRPRPTSPMYYARDRSPMRRPDYALSQTAALASK-------------YRSEAAGF 257

  Fly   183 GKF-GGSAGNEGRFGSNRFQQRDNSGPQPGRRNFKNSPTSGYRGGGNNSDFQGGSSSSGGGGS-- 244
            |.. .|.:|......|:...|..........:....|..||| |....:.:....|:....||  
 Frog   258 GNLASGYSGQASALASSYSNQASALASSYNNQRAYTSSASGY-GTDQIAAYSTQPSAYANQGSSI 321

  Fly   245 ----VNQRAGGGGPGPSHV-RQDRRGFALPVEHQQQQ 276
                ....|...|..|||: ........:|..::|||
 Frog   322 YGTQAASLASSYGSQPSHLSASPYASSVVPSAYRQQQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 56/179 (31%)
RRM_SF 6..70 CDD:302621 28/64 (44%)
rbm14NP_989050.1 RRM1_CoAA 8..76 CDD:241052
RRM2_CoAA 84..151 CDD:241053 29/66 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.