DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and zgc:55733

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:XP_021333116.1 Gene:zgc:55733 / 393968 ZFINID:ZDB-GENE-040426-791 Length:316 Species:Danio rerio


Alignment Length:321 Identity:61/321 - (19%)
Similarity:103/321 - (32%) Gaps:113/321 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKVFVGSLPR--CKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            ::||:|:|..  ....::..:|:.||.:|.|.|....|||...|...|.||:...:|.:..||.:
Zfish    26 SRVFIGNLNTMLVTKADVEAIFSKYGKIVGCSVHKGFAFVQYANERNARAAVNGEDGRMIVGQVL 90

  Fly    68 VVE-AGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNT------------------ 113
            .:. ||.||                                ||.|.|                  
Zfish    91 DINLAGEPK--------------------------------PHRSKTIKRSAGDMYSSSSFDLDY 123

  Fly   114 NFKRNFREEVGGRFSNEGPRSSNSSAAKFGPVR---NESNYRQQRSAPYSKGPPNNESSNQGQ-- 173
            :|:|::.:.:....|...|.....|.|.....|   :.|..|:.:|:..||.......:::.:  
Zfish   124 DFQRDYYDRMYSYPSRVPPPPPPLSRAVIPSKRARVSVSGSRRTKSSFSSKSSQRTSRTSETRTL 188

  Fly   174 -GFRNKFAGGGKFGGSAGNEGRFGSNRFQ-----------------------QRDNS-------- 206
             ...||  ..|.|........:..::..|                       :||:|        
Zfish   189 ISHCNK--KSGCFDLKIYRHIQMRADDLQTIKKELTQIKHKVDYLLESLERMERDHSKKSDVKSA 251

  Fly   207 -----GPQPGRRNFKNSPTSGY--------------RGGGNNSDFQGGSSSSG--GGGSVN 246
                 .||.|:::.:||..:.|              ||..::.:.:.|....|  .|.|.|
Zfish   252 KAEEVSPQHGKKDRENSEMNDYEDEGDLLEEEEIKSRGREDDEEEEDGEQEEGEDDGDSAN 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 40/186 (22%)
RRM_SF 6..70 CDD:302621 20/65 (31%)
zgc:55733XP_021333116.1 RRM <17..166 CDD:223796 36/171 (21%)
RRM_hnRNPC 25..95 CDD:241047 20/68 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.