DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and shep

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001246636.1 Gene:shep / 38605 FlyBaseID:FBgn0052423 Length:590 Species:Drosophila melanogaster


Alignment Length:144 Identity:31/144 - (21%)
Similarity:51/144 - (35%) Gaps:30/144 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVGSL-PRCKPEELRRLFTNYGSVVECDV-----MNR--CAFVHLENTDMAEAAIAALNGTIFK 63
            :::.:| |..|..:|..:.:.||.||...:     ||.  ..|..:|:.:..|..|...||....
  Fly   324 LYIANLPPHFKETDLEAMLSKYGQVVSTRILRDQQMNSKGVGFARMESREKCEQIIQMFNGNTIP 388

  Fly    64 G--QPIVVEAGRPKYGPGGGSRGQPGSGDNPGRR---------------PSQVQGGGADKRPHES 111
            |  .|::|     |:..||..:.......:|..|               |:..|.|.:.......
  Fly   389 GAKDPLLV-----KFADGGPKKKNLFKTPDPNARAWRDVSAEGIPVAYDPTMQQNGVSVNVGTPI 448

  Fly   112 NTNFKRNFREEVGG 125
            ...:.|....:|||
  Fly   449 GVPYSRFSAPQVGG 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 31/144 (22%)
RRM_SF 6..70 CDD:302621 18/72 (25%)
shepNP_001246636.1 RRM1_MSSP 243..313 CDD:240689
RRM2_MSSP 322..400 CDD:240690 20/80 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439599
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.