DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and CG1316

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_647887.1 Gene:CG1316 / 38526 FlyBaseID:FBgn0035526 Length:470 Species:Drosophila melanogaster


Alignment Length:255 Identity:65/255 - (25%)
Similarity:93/255 - (36%) Gaps:86/255 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EELRRLFTNYGSVVECDVM-------NR-CAFVHLENTDMAEAAIAALNG-TIFKGQ---PIVVE 70
            |:.|..|:.||.:.:..|:       |: .|:|....|..|..|...:|| ||.|..   .::|.
  Fly    41 EDFREAFSPYGEIEDIWVVKDKHTQENKGIAYVKFSKTSDAAKAQEEMNGKTIGKMDRTLKVLVA 105

  Fly    71 AGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNF--------REEVGGRF 127
            |.|.:                           |::|..:|.. .:.|.|        .|::...|
  Fly   106 ANRNQ---------------------------GSNKSENEQE-KYVRLFIVIPKTATEEDIREEF 142

  Fly   128 SNEG--------PRSSNSSAAKFGPVRNESNYRQQRSAPYSKGPPNNESSNQGQGFRNKFAGGGK 184
            |..|        ...:|.:...||.||....|       |:.....|.|:.    ::..||    
  Fly   143 SQWGDVESVTIVKEKNNGNPKGFGYVRFTKFY-------YAAVAFENCSAK----YKAVFA---- 192

  Fly   185 FGGSAGNEGRFGSNRFQQRDNSGPQPGRRNFKNSPTSGYRGGGNNSDFQGGSSSSGGGGS 244
                   |.: ||.| .|||..|     |..:::|.....|.| ||:|.||.||||||||
  Fly   193 -------EPK-GSTR-TQRDQYG-----RPSEDNPLYSSSGRG-NSNFNGGGSSSGGGGS 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 37/177 (21%)
RRM_SF 6..70 CDD:302621 17/63 (27%)
CG1316NP_647887.1 RRM1_RBM45 25..105 CDD:240812 17/63 (27%)
RRM2_RBM45 122..195 CDD:240813 18/94 (19%)
RRM3_RBM45 267..339 CDD:240814
RRM4_RBM45 383..449 CDD:240815
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439657
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.