DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and hfp

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_525123.2 Gene:hfp / 38173 FlyBaseID:FBgn0028577 Length:637 Species:Drosophila melanogaster


Alignment Length:149 Identity:36/149 - (24%)
Similarity:60/149 - (40%) Gaps:35/149 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFVGSLP-RCKPEELRRLFTNYGSVVECDVM--------NRCAFVHLENTDMAEAAIAALNGTI 61
            :|:|||:. ..|.:.:|..||.:|.:...::.        ...|||..|..:.|:.|:..:||.:
  Fly   131 RVYVGSISFELKEDTIRVAFTPFGPIKSINMSWDPITQKHKGFAFVEYEIPEGAQLALEQMNGAL 195

  Fly    62 FKGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGR 126
            ..|:.|.|  |||...|                :..||    .|:...|:. :|.|.:...:...
  Fly   196 MGGRNIKV--GRPSNMP----------------QAQQV----IDEVQEEAK-SFNRIYVASIHPD 237

  Fly   127 FSNEGPRSSNSSAAKFGPV 145
            .|.|..:|...:   |||:
  Fly   238 LSEEDIKSVFEA---FGPI 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 36/149 (24%)
RRM_SF 6..70 CDD:302621 19/72 (26%)
hfpNP_525123.2 half-pint 10..637 CDD:130706 36/149 (24%)
RRM1_PUF60 130..205 CDD:240816 20/75 (27%)
RRM2_PUF60 227..303 CDD:240817 7/30 (23%)
RRM3_UHM_PUF60 536..636 CDD:241092
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439574
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.