DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and CG4612

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001246493.1 Gene:CG4612 / 37914 FlyBaseID:FBgn0035016 Length:307 Species:Drosophila melanogaster


Alignment Length:197 Identity:40/197 - (20%)
Similarity:72/197 - (36%) Gaps:50/197 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TAKVFVGSLPR-CKPEELRRLFTNYGSVVECDV-------MNRCAFVHLENTDMAEAAIAALNGT 60
            :.|:::.:|.| ...:.:...|:.:|:::.|:|       .....|||.::.:.|.|||..:||.
  Fly   112 SGKIYIKNLERSIDNKAVYDTFSVFGNILNCNVAKDEDGNSRGYGFVHFDSEEAARAAIEKVNGM 176

  Fly    61 IFKGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGG 125
            :...|.:.|    .|:.|               ||          .|..|..|:||..:.:.:..
  Fly   177 LCNNQKVHV----VKFIP---------------RR----------DREQEKATHFKNLYVKNLSE 212

  Fly   126 RFSNEGPRSSNSSAAKFGPVRNESNYR-----QQRSAPYSKGPPNNESSNQGQ--GFRNKFAGGG 183
            .|:.:..|.      .|.|....::::     :.||..:......|..|....  |...|..|..
  Fly   213 EFTEQHLRE------MFEPYGRITSHKLMLDEEGRSRRFGFVAYENPQSALAAVIGLHGKQLGDN 271

  Fly   184 KF 185
            ||
  Fly   272 KF 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 34/176 (19%)
RRM_SF 6..70 CDD:302621 17/71 (24%)
CG4612NP_001246493.1 RRM2_I_PABPs 115..185 CDD:240825 16/69 (23%)
RRM3_I_PABPs 202..282 CDD:240826 15/78 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439619
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.