DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and TBPH

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001163280.1 Gene:TBPH / 37781 FlyBaseID:FBgn0025790 Length:531 Species:Drosophila melanogaster


Alignment Length:394 Identity:95/394 - (24%)
Similarity:129/394 - (32%) Gaps:113/394 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KVFVGSLPRC----KPEELRRLFTNYGSVVECDV---MNRCAFVHLENTDMAEAAIAALNGTIFK 63
            |||||   ||    ..::||..|:.:|.|.:..:   ....:||...:.|:|::...  ...|.|
  Fly   193 KVFVG---RCTEDINSDDLREYFSKFGEVTDVFIPRPFRAFSFVTFLDPDVAQSLCG--EDHIIK 252

  Fly    64 GQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRFS 128
            |..:.|....||            :..|   |..|||         ..|.|...:|         
  Fly   253 GVSVHVSNAAPK------------AEQN---RNQQVQ---------SYNYNSANSF--------- 284

  Fly   129 NEGPRSSNSSAAKFGPVRN----ESNYRQQRSAPYSKGPPNNESSNQGQGFRNKFAGGGKFGGSA 189
              |..|.:.......|.||    .:|.........:..|.|:.....|.|.     ||..:||::
  Fly   285 --GMHSYHPQGNHMNPGRNGHHRGNNQHNAHGGENAIVPNNHNIGTAGYGM-----GGNNYGGNS 342

  Fly   190 G-----NEGRFGSNRFQQRDNSGPQPGRR--NF--KNSPTSGYRGGGN----------------- 228
            |     |.|...|.....|.:.|.|...|  ||  .|.|.:|..||.|                 
  Fly   343 GGGYHNNGGNHSSGGNTNRQDGGSQYNSRQSNFHGMNQPHNGNVGGSNGWMNRGHLDMPNLQALG 407

  Fly   229 -NSDFQGGSSSSGGGGSVNQ---RAGGGGPGPSHVRQDRRGFAL---PVEHQQQQMGFGRF---- 282
             ||  ||.|||:.|....||   ........|:.|......::|   .:::|.|....|.|    
  Fly   408 INS--QGSSSSNQGQNMSNQSMLNLNSLPINPALVAAALNQWSLVGNQLQNQNQDQQGGNFLSWM 470

  Fly   283 -GNGPMNSGNR--GTNGGNPPGGRGFFNGGGGGFNDRRDSSHETSSPQGGPSKRGGSGGRNHNQN 344
             .||..|:.|.  |..|.|.|......||          ...:.|.||     .|.:|..|.:..
  Fly   471 AQNGGHNNANNFGGRKGPNNPNNNPAANG----------IKTDNSEPQ-----NGNTGWSNQSSG 520

  Fly   345 GINA 348
            ..||
  Fly   521 SQNA 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 38/172 (22%)
RRM_SF 6..70 CDD:302621 19/70 (27%)
TBPHNP_001163280.1 RRM1_TDP43 108..184 CDD:240767
RRM2_TDP43 192..261 CDD:240768 20/72 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.