DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and Rbp9

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001259974.1 Gene:Rbp9 / 33498 FlyBaseID:FBgn0010263 Length:684 Species:Drosophila melanogaster


Alignment Length:391 Identity:89/391 - (22%)
Similarity:126/391 - (32%) Gaps:107/391 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NTTAK----VFVGSL-PRCKPEELRRLFTNYGSVVECDVM-----NRC---AFVHLENTDMAEAA 53
            ||.|.    :||.:| |..:...|.:||..:|:|....|:     |:|   .||.:.|.:.|..|
  Fly   349 NTIASSGWCIFVYNLAPDTEENVLWQLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLA 413

  Fly    54 IAALNGTIFKGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRN 118
            |.:|||... |..::..:.:...........:..:..|.....:.:...|.....|..::|.   
  Fly   414 IQSLNGYTL-GNRVLQVSFKTNKNKQTXLLTKLAAVVNANAAAAALAANGLVLHNHHHHSNI--- 474

  Fly   119 FREEVGGRFSNEGPRSSNSSAAKFGP----VRNESNYRQQRSAPYSKGPPNNESSNQGQGFRNKF 179
                  |..:|....|:..|||.| |    |.:.||.||...        ||.:||..   :.|.
  Fly   475 ------GSINNNSNNSNGCSAAAF-PLGKYVNHSSNNRQHNI--------NNSTSNTS---KQKP 521

  Fly   180 AGGGKFGGSAGNEGRFGSNRFQQRDNSGPQPGRRNFKNSPTSG--YRGGGNNSDFQGGSSSSGGG 242
            |       |..|           :..|...|.|.....:.|:|  ......||.....|:|||..
  Fly   522 A-------STSN-----------KQQSMAPPKRLASSTAATTGDLAATAATNSSSSSHSASSGDA 568

  Fly   243 GSVNQRAGGGGPGPSH------------VRQDRRGFALPVEHQQQQMGFGRF------------G 283
            |:....|.......|.            ..:.:..:.|..:..|.|..|.:|            .
  Fly   569 GATGTAASSSSSSSSTNNNILKTSTKFIYNKPQNQYELLQQQLQLQQEFAQFLTNVANSAATPSS 633

  Fly   284 NGPMNSGNRGTNGGNPPGGRGFFNGGGGGFNDRRDSSHETSSPQGGPSKRGGSGGRNHNQNGINA 348
            ||..||.|:...||....|.|......|                      ||||  |.|.||.|.
  Fly   634 NGSANSTNQRNGGGTIGMGLGMSANSAG----------------------GGSG--NKNSNGNNG 674

  Fly   349 Y 349
            |
  Fly   675 Y 675

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 42/180 (23%)
RRM_SF 6..70 CDD:302621 22/76 (29%)
Rbp9NP_001259974.1 ELAV_HUD_SF 107..438 CDD:273741 25/89 (28%)
RRM1_Hu 109..186 CDD:241094
RRM2_Hu 196..274 CDD:241096
RRM3_Hu 355..432 CDD:240823 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439661
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.