DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and rbm14a

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001108616.1 Gene:rbm14a / 323721 ZFINID:ZDB-GENE-050522-496 Length:471 Species:Danio rerio


Alignment Length:109 Identity:41/109 - (37%)
Similarity:60/109 - (55%) Gaps:14/109 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTTAKVFVGSL-PRCKPEELRRLFTNYGSVVECD-------VMNRCAFVHLENTDMAEAAIAAL 57
            :|:| |||||:| ..|..|:|..||:.||.|::||       .:...|||::|:.:.||.||..|
Zfish    80 LNST-KVFVGNLCASCSVEDLYDLFSPYGKVLDCDKVKTKPSSLTGYAFVYMEHKEDAEQAIEGL 143

  Fly    58 NGTIFKGQPIVVEAGRPKYGPGG---GSRGQPG--SGDNPGRRP 96
            :||.|.|:|:.||..:.:.....   .|.|..|  :|:.|..||
Zfish   144 HGTTFMGRPLAVELSKVQQSTNKVPCASCGAHGHFAGECPINRP 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 40/106 (38%)
RRM_SF 6..70 CDD:302621 30/71 (42%)
rbm14aNP_001108616.1 RRM_SF 7..75 CDD:302621
RRM_SF 84..156 CDD:302621 30/71 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
21.970

Return to query results.
Submit another query.