DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and HNRNPC

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001070910.1 Gene:HNRNPC / 3183 HGNCID:5035 Length:306 Species:Homo sapiens


Alignment Length:180 Identity:44/180 - (24%)
Similarity:71/180 - (39%) Gaps:49/180 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTTAKVFVGSLPR--CKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFK 63
            ||  ::||:|:|..  .|..::..:|:.||.:|.|.|....|||...|...|.||:|..:|.:..
Human    14 MN--SRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIA 76

  Fly    64 GQPIVVE-AGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHES---------NTNFKRN 118
            ||.:.:. |..||.     :||:.|.     :|.:....|...:.|..|         :.:|:|:
Human    77 GQVLDINLAAEPKV-----NRGKAGV-----KRSAAEMYGSVTEHPSPSPLLSSSFDLDYDFQRD 131

  Fly   119 F-------------------------REEVGGRFSNEGPRSSNSSAAKFG 143
            :                         |:.|.|..|..|....||.:.:.|
Human   132 YYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRG 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 42/177 (24%)
RRM_SF 6..70 CDD:302621 22/65 (34%)
HNRNPCNP_001070910.1 RRM_hnRNPC 10..93 CDD:410015 27/85 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 139..190 8/43 (19%)
Nuclear localization signal. /evidence=ECO:0000255 155..161 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 221..306
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.