DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and Spx

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_511058.1 Gene:Spx / 31558 FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster


Alignment Length:132 Identity:28/132 - (21%)
Similarity:53/132 - (40%) Gaps:40/132 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTTAKVFVGSLPRCKPEE-LRRLFTNYGSVVECDVMNR---------CAFVHLENTDMAEAAIA 55
            ::..|.:|:|:|.....|: |...|:.:|.:::...:.|         .||::..:.:.::||:.
  Fly    96 LDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGKSKSFAFINFASFEASDAAMD 160

  Fly    56 ALNGTIFKGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADK------------RP 108
            |:||.....:||.|.....|              |:.|.|    .|..|::            ||
  Fly   161 AMNGQYLCNRPISVSYAFKK--------------DHKGER----HGSAAERLLAAQNPSTHADRP 207

  Fly   109 HE 110
            |:
  Fly   208 HQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 28/129 (22%)
RRM_SF 6..70 CDD:302621 17/73 (23%)
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780
RRM2_SF3B4 99..181 CDD:240781 20/95 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.