DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and ssx

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_569908.1 Gene:ssx / 31086 FlyBaseID:FBgn0024987 Length:485 Species:Drosophila melanogaster


Alignment Length:401 Identity:88/401 - (21%)
Similarity:126/401 - (31%) Gaps:163/401 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVGSLPR-CKPEELRRLFTNYGSVVECDVM--------NRCAFVHLENTDMAEAAIAALNGTIF 62
            ::|.:|.| ...:.|.|:|:.||.:|:.:::        ...|||.....:.|:.||.|||.|:.
  Fly   181 LYVINLSRNINDDMLDRIFSPYGLIVQRNILRDKLTGRPRGVAFVRYNKREEAQEAIKALNNTVP 245

  Fly    63 KG--QPIVV----EAGRPKYGP-----GGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFK 116
            :|  |||.|    |.|:.|...     |||:.|  |.|..|...|     ||....||..|.:  
  Fly   246 EGGSQPIWVRLAEEHGKAKAAQFMAQIGGGNGG--GGGGPPHMGP-----GGPMHPPHHHNNH-- 301

  Fly   117 RNFREEVGGRFSNEGPRSSNSSAAKFGPVRNESNYRQQRSAPYSKGP--PNNESSNQGQGFRNKF 179
                                          :.:|:......|:...|  |:....:..|      
  Fly   302 ------------------------------HHNNHHNPHMPPHHHQPQHPHQHPQHHPQ------ 330

  Fly   180 AGGGKFGGSAGNEGRFGSNRFQQRDNSGPQPGRRNFKNSPTSGYRGGGNNSDFQGGSSSSGGGGS 244
                             .:..|..     .|...| .|.|.:.:....||:              
  Fly   331 -----------------LHHMQHH-----HPNNHN-NNHPNNHHHNNNNNN-------------- 358

  Fly   245 VNQRAGGGGPGPSHVRQDRRGFALPVEHQQQQMGFGRFGNGPMNSGNRGTNGGNPPGGRGFFNGG 309
               ....|||.|.|::|        :......||.|      :|.| .|...|.|..|.|...||
  Fly   359 ---HHNMGGPHPHHMQQ--------MHPMGMNMGMG------VNMG-MGMGMGMPIHGGGGGGGG 405

  Fly   310 GGGFNDRRDSSHETSSPQGGPSKRGGSGGRNHNQNGINAYHSE-----------FP----PLGSG 359
            |||                     ||.||..|:.    |:..|           ||    |:|:|
  Fly   406 GGG---------------------GGGGGNFHHM----AHRGEVFMLPLPICSRFPSQPHPVGNG 445

  Fly   360 -GGGPGQRNRF 369
             ...|.:.:||
  Fly   446 ICHSPNKNSRF 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 44/182 (24%)
RRM_SF 6..70 CDD:302621 24/77 (31%)
ssxNP_569908.1 RRM_SF 93..173 CDD:302621
RRM_SF 179..257 CDD:302621 24/75 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439628
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.