DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and Pabpc4l

DIOPT Version :10

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001099899.1 Gene:Pabpc4l / 295010 RGDID:1559517 Length:370 Species:Rattus norvegicus


Alignment Length:65 Identity:20/65 - (30%)
Similarity:29/65 - (44%) Gaps:7/65 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EELRRLFTNYGSVVECDVM-------NRCAFVHLENTDMAEAAIAALNGTIFKGQPIVVEAGRPK 75
            |.||.:|:.||..:...||       .|..||..::...|:.|:..:||....||.|.|...:.|
  Rat   204 ESLRSVFSKYGQTLSVKVMKDASGKSKRFGFVSFDSHKAAKNAVEDMNGRDINGQTIFVGRAQKK 268

  Fly    76  75
              Rat   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM_SF 6..70 CDD:473069 18/58 (31%)
PABP-1234 <18..173 CDD:130689 20/65 (31%)
Pabpc4lNP_001099899.1 PABP-1234 10..>369 CDD:130689 20/65 (31%)

Return to query results.
Submit another query.