DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and Rbm4

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001163955.1 Gene:Rbm4 / 293663 RGDID:1306891 Length:365 Species:Rattus norvegicus


Alignment Length:287 Identity:66/287 - (22%)
Similarity:110/287 - (38%) Gaps:73/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TAKVFVGSL-PRCKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFKGQPI 67
            :.|:.||:: |.|..:|||..|..||.|:|||::...||||:|..:.|..||..|:.|.|:|:.:
  Rat    77 STKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKRM 141

  Fly    68 VVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESN---TNFKRNFREEVGG---- 125
            .|:....:.      |..||.||..|......:|..:.:.|.:.:   .:....:.|:.|.    
  Rat   142 HVQLSTSRL------RTAPGMGDQSGCYRCGKEGHWSKECPIDRSGRVADLTEQYNEQYGAVRTP 200

  Fly   126 ---------RFSN------------EGPRSSNSSAAKFGPVRNESNYRQQRSA------------ 157
                     .::|            ...||..:.||......|  ||.:|..:            
  Rat   201 YTMSYGDSLYYNNTYGALDAYYKRCRAARSYEAVAAAAASAYN--NYAEQTLSQLPQVQNTAMAS 263

  Fly   158 --------PYSKG--PPNNESSNQGQGFRNKFAGGGKFGGSAGNEGRFGSNRFQQRDNSGPQPGR 212
                    ||::.  ||:      |.......|.......:|.:...:|.:|...|..:||.|  
  Rat   264 HLTSTSLDPYNRHLLPPS------GAAAAAAAAAAAAAACTAASTPYYGRDRSPLRRATGPVP-- 320

  Fly   213 RNFKNSPTSGYRGGGNNSDFQGGSSSS 239
                 :...|| |.|::|:....|:::
  Rat   321 -----TVGEGY-GYGHDSELSQASAAA 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 51/214 (24%)
RRM_SF 6..70 CDD:302621 27/64 (42%)
Rbm4NP_001163955.1 RRM1_RBM4 2..68 CDD:410018
RRM2_RBM4 78..144 CDD:410019 27/65 (42%)
PTZ00368 <145..>181 CDD:173561 8/41 (20%)
ZnF_C2HC 161..176 CDD:197667 2/14 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1563362at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.