DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and Hnrnpc

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001264529.1 Gene:Hnrnpc / 290046 RGDID:1309982 Length:313 Species:Rattus norvegicus


Alignment Length:320 Identity:68/320 - (21%)
Similarity:108/320 - (33%) Gaps:111/320 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNTTAKVFVGSLPR--CKPEELRRLFTNYGSVVECDVMNRCAFVHLENTDMAEAAIAALNGTIFK 63
            ||  ::||:|:|..  .|..::..:|:.||.:|.|.|....|||...|...|.||:|..:|.:..
  Rat    14 MN--SRVFIGNLNTLVVKKSDVEAIFSKYGKIVGCSVHKGFAFVQYVNERNARAAVAGEDGRMIA 76

  Fly    64 GQPIVVE-AGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHES---------NTNFKRN 118
            ||.:.:. |..||.     :||:.|.     :|.:....|...:.|..|         :.:|:|:
  Rat    77 GQVLDINLAAEPKV-----NRGKAGV-----KRSAAEMYGSVPEHPSPSPLLSSSFDLDYDFQRD 131

  Fly   119 F-------------------------REEVGGRFSNEGPRSSNS------SAAKFGPVRNES--- 149
            :                         |:.|.|..|..|....||      |::|.|.::.:.   
  Rat   132 YYDRMYSYPARVPPPPPIARAVVPSKRQRVSGNTSRRGKSGFNSKSGQRGSSSKSGKLKGDDLQA 196

  Fly   150 ----------------------NYRQQRSAPYSKGPP---NNESSNQGQGFRN--KFAGGGKFGG 187
                                  ...|.:.|..|...|   .||.|.:.|...:  |.....|...
  Rat   197 IKKELTQIKQKVDSLLESLEKIEKEQSKQADLSFSSPVEMKNEKSEEEQSSASVKKDETNVKMES 261

  Fly   188 SAG---------------NEGRFGSNRFQQRDN-SGPQPGRRNFKNSPTSGYRGGGNNSD 231
            .||               ||.| |.::.:.:|: ..|:.|..:         |...|..|
  Rat   262 EAGADDSAEEGDLLDDDDNEDR-GDDQLELKDDEKEPEEGEDD---------RDSANGED 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 49/234 (21%)
RRM_SF 6..70 CDD:302621 22/65 (34%)
HnrnpcNP_001264529.1 RRM_hnRNPC 10..93 CDD:410015 27/85 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.