DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and rbm-34

DIOPT Version :10

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_502291.1 Gene:rbm-34 / 178148 WormBaseID:WBGene00008688 Length:394 Species:Caenorhabditis elegans


Alignment Length:32 Identity:11/32 - (34%)
Similarity:22/32 - (68%) Gaps:1/32 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVGSLPRCKPEE-LRRLFTNYGSVVECDVMN 37
            ||||::|....|: :||:|:::|::....:.|
 Worm   145 VFVGNMPLTMNEKSVRRIFSDFGTISSVRMRN 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM_SF 6..70 CDD:473069 11/32 (34%)
PABP-1234 <18..173 CDD:130689 6/21 (29%)
rbm-34NP_502291.1 RRM1_RBM34 144..233 CDD:409828 11/32 (34%)
RRM2_RBM34 248..320 CDD:409829
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.