DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and msi-1

DIOPT Version :10

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001369851.1 Gene:msi-1 / 175514 WormBaseID:WBGene00003423 Length:320 Species:Caenorhabditis elegans


Alignment Length:200 Identity:44/200 - (22%)
Similarity:68/200 - (34%) Gaps:70/200 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TAKVFVGSLPRCKP-EELRRLFTNYGSVVECDVM--------NRCAFVHLENTDMA----EAAIA 55
            |.|||:|.|..... |::::.|..||.|.:..:|        ....||..::.::|    |....
 Worm   133 TKKVFIGGLSATSTLEDMKQYFETYGKVEDAMLMFDKATQRHRGFGFVTFDSDEVADKVCEIHFH 197

  Fly    56 ALNGTIF---KGQPIVV-----------EAGRPKYGPG--------------GGS---------- 82
            .:||.:.   |.||..|           .|.|..||..              ||:          
 Worm   198 EINGKMVECKKAQPKEVMLPVQLNKSRAAAARNLYGMPPETLLAYAQYLPRFGGNLMYPNFTNVF 262

  Fly    83 RGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRFS-NEGPRSSNSSAAKFGPVR 146
            ...||     |.......||.:::.||:.:|          ...:| |.|.:..:|.|..|   .
 Worm   263 NNMPG-----GYSGLSTPGGSSNRPPHQFDT----------ASLYSLNNGGQLLDSQAQMF---M 309

  Fly   147 NESNY 151
            |:.:|
 Worm   310 NQQSY 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM_SF 6..70 CDD:473069 21/90 (23%)
PABP-1234 <18..173 CDD:130689 37/184 (20%)
msi-1NP_001369851.1 RRM1_MSI 46..121 CDD:409990
RRM2_MSI 135..208 CDD:240769 17/72 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.