DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and exc-7

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_496057.1 Gene:exc-7 / 174506 WormBaseID:WBGene00001368 Length:456 Species:Caenorhabditis elegans


Alignment Length:295 Identity:55/295 - (18%)
Similarity:85/295 - (28%) Gaps:127/295 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVGSLPR-CKPEELRRLFTNYGSVVECDVMN--------RCAFVHLENTDMAEAAIAALNGTIF 62
            :.:..||: ...||:|.|||:.|.:..|.::.        ...||:....:.|..|:::.||...
 Worm    44 LIINYLPQGMTQEEVRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVREEDALRAVSSFNGLRL 108

  Fly    63 KGQPIVVEAGRPKYGPGGGSRGQPGSGDNPGRRPSQVQGGGADKRPHESNTNFKRNFREEVGGRF 127
            :.:.|.|...||                                                     
 Worm   109 QNKTIKVSYARP----------------------------------------------------- 120

  Fly   128 SNEGPRSSNSSAAKFGPVRNESNYRQQRSAPYSKGPPNNESSNQ--------GQGFRNKFAGGGK 184
            ||:..:.||.                     |..|.|.:.:.::        ||...::......
 Worm   121 SNDQIKGSNL---------------------YVSGIPKSMTLHELESIFRPFGQIITSRILSDNV 164

  Fly   185 FGGSAGNEGRFGSNRFQQRDN--------SGPQPG------RRNFKNSPTSGYRGGGNN-----S 230
            .|.|.|    .|..||.::|.        :|..|.      ...|.|:|.|      ||     |
 Worm   165 TGLSKG----VGFVRFDKKDEADVAIKTLNGSIPSGCSEQITVKFANNPAS------NNPKGLLS 219

  Fly   231 DFQGGSSS-------SGGGGSVNQRAGGGGPGPSH 258
            |.:....:       |...|:...||..||.||.|
 Worm   220 DLEAVQQAATTLVPLSTILGAPTLRATAGGIGPMH 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 27/169 (16%)
RRM_SF 6..70 CDD:302621 17/71 (24%)
exc-7NP_496057.1 ELAV_HUD_SF 39..455 CDD:273741 55/295 (19%)
RRM1_Hu 41..118 CDD:241094 18/73 (25%)
RRM2_Hu 128..206 CDD:241096 16/102 (16%)
RRM3_Hu 373..449 CDD:240823
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.