DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and ztf-4

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_491976.2 Gene:ztf-4 / 172422 WormBaseID:WBGene00020399 Length:367 Species:Caenorhabditis elegans


Alignment Length:159 Identity:36/159 - (22%)
Similarity:63/159 - (39%) Gaps:35/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKVFVGSLPRC--KPEELRRLFTNYGSVVECD--VMNRCAFVHLENTDMAEAAIAALNGTIFKGQ 65
            |:||:|::.|.  ..:::..||..:|.::..:  ......||.......|:.:..:|||..:|..
 Worm    83 ARVFIGNIARAIITRDDIIELFRPFGKIIAVNYFAQQGFGFVQFNEAGSADESCRSLNGMSWKAC 147

  Fly    66 PIVVEAG------RPKYGPGGGSRGQPGSGDNPGRRP-----------SQVQGGGADKRPHESNT 113
            .:.|...      :|.     |:.|:.|:...|...|           :..|..   |||:|...
 Worm   148 CLDVHLAMLGSLRKPT-----GNEGRQGNTIAPAPLPVGKPLTQHAVDTSAQSA---KRPYEDEE 204

  Fly   114 N--FKRNFREEVGGRFSNEGPRSSNSSAA 140
            .  ||:|.|.:   :|:| |..:.|...|
 Worm   205 YEIFKQNKRNK---QFAN-GDTTINEQLA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 36/159 (23%)
RRM_SF 6..70 CDD:302621 14/67 (21%)
ztf-4NP_491976.2 RRM <64..272 CDD:223796 36/159 (23%)
RRM_SF 83..151 CDD:388407 15/67 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.