DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7903 and zcrb1

DIOPT Version :9

Sequence 1:NP_651755.2 Gene:CG7903 / 43554 FlyBaseID:FBgn0039730 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001107973.1 Gene:zcrb1 / 100135752 XenbaseID:XB-GENE-999756 Length:215 Species:Xenopus tropicalis


Alignment Length:80 Identity:20/80 - (25%)
Similarity:36/80 - (45%) Gaps:13/80 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VFVGSLP-RCKPEELRRLFTNYGSVVECDVM--------NRCAFVHLENTDMAEAAIAALNGTIF 62
            |:|.:|| .....:|.|:|:.||.||:..::        ...|||...:.:.::..:..||....
 Frog    12 VYVSNLPFSLTNNDLHRIFSKYGKVVKVTILKDKDSRRSKGVAFVLFLDKESSQNCVRGLNNKQL 76

  Fly    63 KGQ----PIVVEAGR 73
            .|:    .|.::.||
 Frog    77 FGRAIKASIAIDNGR 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7903NP_651755.2 RRM <4..168 CDD:223796 20/80 (25%)
RRM_SF 6..70 CDD:302621 18/75 (24%)
zcrb1NP_001107973.1 RRM_ZCRB1 9..86 CDD:240839 17/73 (23%)
PTZ00368 <97..123 CDD:173561
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.