DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and TRIL

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_055632.2 Gene:TRIL / 9865 HGNCID:22200 Length:811 Species:Homo sapiens


Alignment Length:433 Identity:122/433 - (28%)
Similarity:182/433 - (42%) Gaps:107/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 DLKEFYIDRNSLTSVPTNSLNGPSALRHLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRSIDS 249
            |:..:.:..|.:|::.....:....||.|.|:.|||.||...:|....:||.:.|.:|:::::..
Human    60 DVLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQALAP 124

  Fly   250 LAFKGLQKIREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVALAAVPGLKHLNLSSN 314
            .....|:|:|.:...||.||.|:...||.|:||.||.|..|..|..|....|.:..|.:|:|.||
Human   125 GTLAPLRKLRILYANGNEISRLSRGSFEGLESLVKLRLDGNALGALPDAVFAPLGNLLYLHLESN 189

  Fly   315 MLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQ 379
            .::.|                .:|        .|.::|.|::|:||.|.|:              
Human   190 RIRFL----------------GKN--------AFAQLGKLRFLNLSANELQ-------------- 216

  Fly   380 TLIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPG 444
                                |.|        |.||..|.:      ..:::|.||.|.::.|.|.
Human   217 --------------------PSL--------RHAATFAPL------RSLSSLILSANNLQHLGPR 247

  Fly   445 SFQMFSSLHTLDLSGNSLAVINADTFAGLESTLMALKLSQNRLTGLGGAPWVLPE----LRSLDL 505
            .||....|..|.|.||.|..:..:.|.|||: |..|:|..|||:.|   |..|.|    |.:|||
Human   248 IFQHLPRLGLLSLRGNQLTHLAPEAFWGLEA-LRELRLEGNRLSQL---PTALLEPLHSLEALDL 308

  Fly   506 SGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLSG------CNIRQI--- 561
            |||.|:.|....|..|..::.|:|..|.|:.|:|.:|.....|..:||.|      |.:|.:   
Human   309 SGNELSALHPATFGHLGRLRELSLRNNALSALSGDIFAASPALYRLDLDGNGWTCDCRLRGLKRW 373

  Fly   562 ------SGDLLAGLQDLKH---------IYLNDNQLQELQDGS 589
                  .|.||......:|         .||:|   |:||:||
Human   374 MGDWHSQGRLLTVFVQCRHPPALRGKYLDYLDD---QQLQNGS 413

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268 54/224 (24%)
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380 122/433 (28%)
leucine-rich repeat 186..209 CDD:275380 2/22 (9%)
leucine-rich repeat 210..233 CDD:275380 10/22 (45%)
leucine-rich repeat 234..257 CDD:275380 5/22 (23%)
PLN00113 237..>750 CDD:215061 107/381 (28%)
leucine-rich repeat 258..281 CDD:275380 9/22 (41%)
leucine-rich repeat 282..329 CDD:275380 14/46 (30%)
leucine-rich repeat 330..353 CDD:275380 2/22 (9%)
leucine-rich repeat 354..377 CDD:275380 6/22 (27%)
leucine-rich repeat 378..401 CDD:275380 0/22 (0%)
leucine-rich repeat 402..425 CDD:275380 5/22 (23%)
leucine-rich repeat 428..451 CDD:275380 8/22 (36%)
leucine-rich repeat 452..473 CDD:275380 7/20 (35%)
leucine-rich repeat 477..497 CDD:275378 8/19 (42%)
leucine-rich repeat 500..523 CDD:275380 11/22 (50%)
leucine-rich repeat 524..547 CDD:275380 7/22 (32%)
leucine-rich repeat 548..571 CDD:275380 9/37 (24%)
leucine-rich repeat 572..595 CDD:275380 9/27 (33%)
leucine-rich repeat 596..619 CDD:275380
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
leucine-rich repeat 668..691 CDD:275380
LRR <684..1020 CDD:443914
leucine-rich repeat 692..715 CDD:275380
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507