DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and RLP38

DIOPT Version :9

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_188953.1 Gene:RLP38 / 821887 AraportID:AT3G23120 Length:784 Species:Arabidopsis thaliana


Alignment Length:874 Identity:210/874 - (24%)
Similarity:328/874 - (37%) Gaps:242/874 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 NSLTSVPTNSLNGPSALRHLSLRQNQIGSLLADSFNAQRQLEI--IDLRHNVIRSIDSLAFKG-- 254
            |:..|.||.||          .|.:|..:||    ..|::..|  :.|::...:.||..::.|  
plant    27 NTFASPPTQSL----------CRHDQRDALL----ELQKEFPIPSVILQNPWNKGIDCCSWGGVT 77

  Fly   255 ----LQKIREIK---LAGNRISHLNSDVFEKLQSLQKLDLSE-NFFGQFPTVALAAVPGLKHLNL 311
                |.::..:|   |:....|..:|....|||.|..||||. |..|:.|    :::..|.||  
plant    78 CDAILGEVISLKLYFLSTASTSLKSSSALFKLQHLTHLDLSNCNLQGEIP----SSIENLSHL-- 136

  Fly   312 SSNMLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLD 376
                      ||         ||:|.|.:....|.:...:..|:|:||..|.||.....:...|.
plant   137 ----------TH---------LDLSTNHLVGEVPASIGNLNQLEYIDLRGNHLRGNIPTSFANLT 182

  Fly   377 SLQTLIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIREL 441
            .|..|.:.:||                                   ...|||...:|:...|.:|
plant   183 KLSLLDLHENN-----------------------------------FTGGDIVLSNLTSLAILDL 212

  Fly   442 PPGSFQMFSSLHTLDLSG-NSLAVI--NADTFAGL-------ESTLMALKLSQNRLTGLGGAPWV 496
            ....|:.|.|   .|||| ::|..|  |.::|.||       .|:|..::||||:..|       
plant   213 SSNHFKSFFS---ADLSGLHNLEQIFGNENSFVGLFPASLLKISSLDKIQLSQNQFEG------- 267

  Fly   497 LPELRSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLSGCNIRQI 561
                 .:|. |||.:....|:         |::|.|:......:....|..|:::|||..|.|.:
plant   268 -----PIDF-GNTSSSSRLTM---------LDISHNNFIGRVPSSLSKLVNLELLDLSHNNFRGL 317

  Fly   562 SGDLLAGLQDLKHIYLNDNQLQELQDGSFVNLW---NISSIDLSNNRIGSI-RSGAFVNVMKLQK 622
            |...::.|.:|..:.::.|:| |.|...|:  |   |:.|:|||:|....: :|...||..||..
plant   318 SPRSISKLVNLTSLDISYNKL-EGQVPYFI--WKPSNLQSVDLSHNSFFDLGKSVEVVNGAKLVG 379

  Fly   623 LDLHGNQLSA--------FKGEYFNTGTGIEELDISDNQLSYLFPSSFRIHPRLREIRAANNKFS 679
            |:|..|.|..        |:..:|        ||:|||:.:...|...:.......:...||..|
plant   380 LNLGSNSLQGPIPQWICNFRFVFF--------LDLSDNRFTGSIPQCLKNSTDFNTLNLRNNSLS 436

  Fly   680 FFPAELISTLQYLEHIDLSHNQLKTIEELDFARLPR-------LRVLLVANNQLDMVSEMAFHNS 737
            .|..||......|..:|:|:|..       ..:||:       :..|.|..|::.........:.
plant   437 GFLPELCMDSTMLRSLDVSYNNF-------VGKLPKSLMNCQDMEFLNVRGNKIKDTFPFWLGSR 494

  Fly   738 TQLQILDLAHNNL--DRIGERTFEGLVRLEQLNLEGNR-LSELSDGVF----ERTKLQMLENINL 795
            ..|.:|.|..|..  ......|:.|..||..:::..|. :..|....|    |...:..:..:|.
plant   495 KSLMVLVLRSNAFYGPVYNSTTYLGFPRLSIIDISNNDFVGSLPQDYFANWTEMATVWDINRLNY 559

  Fly   796 AHN----RFEYAPLNALQRQFF-------FVSSVDLSHNKIKELPGD-DSIMVNIKRIDLSFNPL 848
            |.|    ..:|..|..:||..:       ...|:||::   |.:..| :.|....|.||.|.|..
plant   560 ARNTSSRTIQYGGLQTIQRSNYVGDNFNMHADSMDLAY---KGVDTDFNRIFRGFKVIDFSGNRF 621

  Fly   849 SSKAVHNVLNEPKTVRELSLAGTGIENLELLETPFLQFLNLSHNKLKNVKPEVFQRVTLLETLDL 913
            |.       :.|:::..||         |||.      ||||.|......|.....:|.||||||
plant   622 SG-------HIPRSIGLLS---------ELLH------LNLSGNAFTGNIPPSLANITNLETLDL 664

  Fly   914 SSNQLESLEDLSMAWPQLQVLQSLDVSNNSFEIVSQSNFGKLEMLRSLRLSH------LPQCTRI 972
            |.|.|..           ::.:||               |.|..|.::..||      :|:.|:.
plant   665 SRNNLSG-----------EIPRSL---------------GNLSFLSNINFSHNHLQGFVPRSTQF 703

  Fly   973 ---EKNAFKQLPNLVSL-----EAYDLPL 993
               ..::|...|.|..|     |::.:|:
plant   704 GTQNCSSFVGNPGLYGLDEICRESHHVPV 732

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 LRR_8 109..172 CDD:290566
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064 40/155 (26%)
leucine-rich repeat 133..161 CDD:275380
LRR_8 160..220 CDD:290566 7/25 (28%)
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380 6/14 (43%)
leucine-rich repeat 210..233 CDD:275380 5/22 (23%)
LRR_8 232..290 CDD:290566 18/69 (26%)
leucine-rich repeat 234..257 CDD:275380 6/30 (20%)
leucine-rich repeat 258..281 CDD:275380 6/25 (24%)
LRR_RI 273..535 CDD:238064 68/272 (25%)
LRR_8 281..338 CDD:290566 16/57 (28%)
leucine-rich repeat 282..329 CDD:275380 13/47 (28%)
LRR_8 328..388 CDD:290566 16/59 (27%)
leucine-rich repeat 330..353 CDD:275380 5/22 (23%)
leucine-rich repeat 354..377 CDD:275380 8/22 (36%)
leucine-rich repeat 378..401 CDD:275380 4/22 (18%)
leucine-rich repeat 402..425 CDD:275380 0/22 (0%)
leucine-rich repeat 428..451 CDD:275380 6/22 (27%)
LRR_8 429..487 CDD:290566 22/67 (33%)
leucine-rich repeat 452..473 CDD:275380 8/23 (35%)
leucine-rich repeat 477..497 CDD:275378 6/19 (32%)
LRR_8 498..558 CDD:290566 13/59 (22%)
leucine-rich repeat 500..523 CDD:275380 5/22 (23%)
LRR_RI 502..769 CDD:238064 70/287 (24%)
leucine-rich repeat 524..547 CDD:275380 4/22 (18%)
leucine-rich repeat 548..571 CDD:275380 8/22 (36%)
LRR_8 572..630 CDD:290566 21/61 (34%)
leucine-rich repeat 572..595 CDD:275380 7/25 (28%)
leucine-rich repeat 596..619 CDD:275380 8/23 (35%)
LRR_8 619..678 CDD:290566 16/66 (24%)
leucine-rich repeat 620..643 CDD:275380 7/30 (23%)
leucine-rich repeat 644..667 CDD:275380 6/22 (27%)
LRR_8 666..726 CDD:290566 15/66 (23%)
leucine-rich repeat 668..691 CDD:275380 6/22 (27%)
leucine-rich repeat 692..715 CDD:275380 5/22 (23%)
LRR_8 714..774 CDD:290566 13/69 (19%)
leucine-rich repeat 716..739 CDD:275380 3/22 (14%)
leucine-rich repeat 740..761 CDD:275380 5/22 (23%)
leucine-rich repeat 764..789 CDD:275380 5/29 (17%)
leucine-rich repeat 790..810 CDD:275380 5/23 (22%)
leucine-rich repeat 818..850 CDD:275380 10/32 (31%)
leucine-rich repeat 863..883 CDD:275378 5/19 (26%)
LRR_RI <878..1070 CDD:238064 33/130 (25%)
LRR_8 884..944 CDD:290566 18/59 (31%)
LRR_4 884..925 CDD:289563 16/40 (40%)
leucine-rich repeat 884..907 CDD:275380 6/22 (27%)
leucine-rich repeat 908..933 CDD:275380 9/24 (38%)
leucine-rich repeat 934..955 CDD:275380 3/20 (15%)
leucine-rich repeat 958..982 CDD:275380 6/32 (19%)
leucine-rich repeat 983..1055 CDD:275380 4/16 (25%)
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
TPKR_C2 1121..1168 CDD:301599
RLP38NP_188953.1 PLN00113 11..>721 CDD:331614 207/861 (24%)
leucine-rich repeat 112..135 CDD:275380 9/26 (35%)
leucine-rich repeat 136..159 CDD:275380 8/43 (19%)
leucine-rich repeat 160..183 CDD:275380 8/22 (36%)
leucine-rich repeat 184..206 CDD:275380 8/56 (14%)
leucine-rich repeat 207..254 CDD:275380 15/49 (31%)
leucine-rich repeat 255..276 CDD:275380 10/33 (30%)
leucine-rich repeat 280..303 CDD:275380 5/31 (16%)
leucine-rich repeat 304..327 CDD:275380 8/22 (36%)
leucine-rich repeat 352..376 CDD:275380 8/23 (35%)
leucine-rich repeat 377..397 CDD:275380 5/19 (26%)
leucine-rich repeat 401..424 CDD:275380 7/30 (23%)
leucine-rich repeat 425..448 CDD:275380 6/22 (27%)
leucine-rich repeat 449..472 CDD:275380 6/29 (21%)
leucine-rich repeat 473..496 CDD:275380 3/22 (14%)
leucine-rich repeat 523..545 CDD:275380 4/21 (19%)
leucine-rich repeat 659..682 CDD:275380 13/48 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.