DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7896 and ISLR2

DIOPT Version :9

Sequence 1:	NP_651754.1	Gene:	CG7896 / 43552	FlyBaseID:	FBgn0039728	Length:	1392	Species:	Drosophila melanogaster
Sequence 2:	NP_001123608.1	Gene:	ISLR2 / 57611	HGNCID:	29286	Length:	745	Species:	Homo sapiens

Alignment Length:	201	Identity:	61/201 - (30%)
Similarity:	98/201 - (48%)	Gaps:	17/201 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   329 SLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQTLIIKDNNILLVPG 393
            ::.:|.:|.|.||.:..|.|.::..:..|.|:.|.:||:|..||..|..|:.|.:..|.|...|.
Human    52 NVTTLSLSANKITVLRRGAFADVTQVTSLWLAHNEVRTVEPGALAVLSQLKNLDLSHNFISSFPW 116

  Fly   394 SALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLS 458
            |.|..|..|..|::::||:.:|..:.||:|.  |:.:|.::.|.:|.|.||:|...|:|..|.|.
Human   117 SDLRNLSALQLLKMNHNRLGSLPRDALGALP--DLRSLRINNNRLRTLAPGTFDALSALSHLQLY 179

  Fly   459 GN----SLAVINADTFAGLESTLMAL----KLSQNRLTGLGGAP-WVLPEL----RSLDLSGNTL 510
            .|    ...::....:|.  ||.::|    .::......|.|.| :.||.|    .|:.||....
Human   180 HNPFHCGCGLVWLQAWAA--STRVSLPEPDSIACASPPALQGVPVYRLPALPCAPPSVHLSAEPP 242

  Fly   511 TELPST 516
            .|.|.|
Human   243 LEAPGT 248

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7896	NP_651754.1	LRR_8	109..172	CDD:290566
		leucine-rich repeat	109..132	CDD:275380
		LRR_RI	<132..338	CDD:238064	2/8 (25%)
		leucine-rich repeat	133..161	CDD:275380
		LRR_8	160..220	CDD:290566
		leucine-rich repeat	162..185	CDD:275380
		leucine-rich repeat	186..209	CDD:275380
		leucine-rich repeat	210..233	CDD:275380
		LRR_8	232..290	CDD:290566
		leucine-rich repeat	234..257	CDD:275380
		leucine-rich repeat	258..281	CDD:275380
		LRR_RI	273..535	CDD:238064	61/201 (30%)
		LRR_8	281..338	CDD:290566	2/8 (25%)
		leucine-rich repeat	282..329	CDD:275380	61/201 (30%)
		LRR_8	328..388	CDD:290566	19/58 (33%)
		leucine-rich repeat	330..353	CDD:275380	7/22 (32%)
		leucine-rich repeat	354..377	CDD:275380	9/22 (41%)
		leucine-rich repeat	378..401	CDD:275380	8/22 (36%)
		leucine-rich repeat	402..425	CDD:275380	8/22 (36%)
		leucine-rich repeat	428..451	CDD:275380	7/22 (32%)
		LRR_8	429..487	CDD:290566	16/65 (25%)
		leucine-rich repeat	452..473	CDD:275380	5/24 (21%)
		leucine-rich repeat	477..497	CDD:275378	4/24 (17%)
		LRR_8	498..558	CDD:290566	8/23 (35%)
		leucine-rich repeat	500..523	CDD:275380	7/21 (33%)
		LRR_RI	502..769	CDD:238064	6/15 (40%)
		leucine-rich repeat	524..547	CDD:275380
		leucine-rich repeat	548..571	CDD:275380
		LRR_8	572..630	CDD:290566
		leucine-rich repeat	572..595	CDD:275380
		leucine-rich repeat	596..619	CDD:275380
		LRR_8	619..678	CDD:290566
		leucine-rich repeat	620..643	CDD:275380
		leucine-rich repeat	644..667	CDD:275380
		LRR_8	666..726	CDD:290566
		leucine-rich repeat	668..691	CDD:275380
		leucine-rich repeat	692..715	CDD:275380
		LRR_8	714..774	CDD:290566
		leucine-rich repeat	716..739	CDD:275380
		leucine-rich repeat	740..761	CDD:275380
		leucine-rich repeat	764..789	CDD:275380
		leucine-rich repeat	790..810	CDD:275380
		leucine-rich repeat	818..850	CDD:275380
		leucine-rich repeat	863..883	CDD:275378
		LRR_RI	<878..1070	CDD:238064
		LRR_8	884..944	CDD:290566
		LRR_4	884..925	CDD:289563
		leucine-rich repeat	884..907	CDD:275380
		leucine-rich repeat	908..933	CDD:275380
		leucine-rich repeat	934..955	CDD:275380
		leucine-rich repeat	958..982	CDD:275380
		leucine-rich repeat	983..1055	CDD:275380
		leucine-rich repeat	1009..1033	CDD:275380
		leucine-rich repeat	1058..1085	CDD:275380
		TPKR_C2	1121..1168	CDD:301599
ISLR2	NP_001123608.1	leucine-rich repeat	36..52	CDD:275380	61/201 (30%)
		LRR_8	52..109	CDD:404697	18/56 (32%)
		LRR 1	52..73		7/20 (35%)
		leucine-rich repeat	53..76	CDD:275380	7/22 (32%)
		LRR 2	76..97		8/20 (40%)
		leucine-rich repeat	77..100	CDD:275380	9/22 (41%)
		LRR_8	99..159	CDD:404697	19/61 (31%)
		LRR 3	100..123		7/22 (32%)
		leucine-rich repeat	101..124	CDD:275380	8/22 (36%)
		LRR 4	124..145		6/20 (30%)
		leucine-rich repeat	125..148	CDD:275380	8/24 (33%)
		LRR 5	148..169		8/20 (40%)
		leucine-rich repeat	149..172	CDD:275380	7/22 (32%)
		PCC	154..>228	CDD:188093	20/75 (27%)
		Ig_3	232..359	CDD:404760	6/17 (35%)
		Ig strand B	256..263	CDD:409353
		Ig strand C	269..274	CDD:409353
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	287..326
		Ig strand C'	305..307	CDD:409353
		Ig strand D	331..335	CDD:409353
		Ig strand E	338..343	CDD:409353
		Ig strand F	351..359	CDD:409353
		Ig strand G	362..372	CDD:409353
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	375..466
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	656..722
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24366
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	2.010