DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and LOC563710

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:XP_692159.4 Gene:LOC563710 / 563710 -ID:- Length:635 Species:Danio rerio


Alignment Length:348 Identity:93/348 - (26%)
Similarity:152/348 - (43%) Gaps:77/348 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 DLKEFYIDRNSLTSVPTNSLNGPSALRHLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRSIDS 249
            |.|..|.:.::...||.|...|   .:.||||.|.:.||.|..|....||..:.|.||.|.::|:
Zfish    38 DGKIVYCESSAFRDVPKNLSGG---CQGLSLRYNSLASLKAGQFVGLNQLIWLYLDHNYIANVDA 99

  Fly   250 LAFKGLQKIREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVALAAVPGLKHLNLSSN 314
            .||:|:::::|:.|:.|:|:.|::..|.                        .||.|::|:||.|
Zfish   100 RAFQGIRRLKELILSSNKITLLHNTTFH------------------------LVPNLRNLDLSYN 140

  Fly   315 MLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQ 379
            .||.|.....|.:|.|.||.:..|::..:....|::...|::|||..|.||:|..:::.||..|.
Zfish   141 KLQALQPGQFQGLRKLLSLHMRSNSLKNLPSRLFQDCRNLEFLDLGYNRLRSITRNSMSGLLKLT 205

  Fly   380 TLIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPG 444
            .|.|:.|....:......|...|.:|.|.:||                          ||.:..|
Zfish   206 ELHIEHNQFSKINFFNFPRFYNLRALYLQWNR--------------------------IRTMSEG 244

  Fly   445 SFQMFSSLHTLDLSGNSLAVINADTFAGLESTLMALKLSQNRLTGLGGAPWVLPELRSLDLSGNT 509
            ...|::||..||||||.|..|:|:.:.                        .:|.|::|:|..|.
Zfish   245 LTWMWTSLQKLDLSGNDLQEIDAEVYR------------------------AMPNLQTLNLDSNK 285

  Fly   510 LTELPSTIFEELENVQSLNLSGN 532
            |..:.....:...::.:::|:||
Zfish   286 LVNVSQEAVDAWTSLTAISLAGN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268 67/224 (30%)
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380 93/348 (27%)
leucine-rich repeat 186..209 CDD:275380 6/22 (27%)
leucine-rich repeat 210..233 CDD:275380 9/22 (41%)
leucine-rich repeat 234..257 CDD:275380 9/22 (41%)
PLN00113 237..>750 CDD:215061 75/296 (25%)
leucine-rich repeat 258..281 CDD:275380 6/22 (27%)
leucine-rich repeat 282..329 CDD:275380 11/46 (24%)
leucine-rich repeat 330..353 CDD:275380 5/22 (23%)
leucine-rich repeat 354..377 CDD:275380 10/22 (45%)
leucine-rich repeat 378..401 CDD:275380 5/22 (23%)
leucine-rich repeat 402..425 CDD:275380 5/22 (23%)
leucine-rich repeat 428..451 CDD:275380 4/22 (18%)
leucine-rich repeat 452..473 CDD:275380 10/20 (50%)
leucine-rich repeat 477..497 CDD:275378 0/19 (0%)
leucine-rich repeat 500..523 CDD:275380 5/22 (23%)
leucine-rich repeat 524..547 CDD:275380 3/9 (33%)
leucine-rich repeat 548..571 CDD:275380
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
leucine-rich repeat 668..691 CDD:275380
LRR <684..1020 CDD:443914
leucine-rich repeat 692..715 CDD:275380
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
LOC563710XP_692159.4 leucine-rich repeat 60..83 CDD:275380 9/22 (41%)
LRR 63..>308 CDD:443914 84/318 (26%)
leucine-rich repeat 84..107 CDD:275380 9/22 (41%)
leucine-rich repeat 108..131 CDD:275380 7/46 (15%)
leucine-rich repeat 132..155 CDD:275380 9/22 (41%)
leucine-rich repeat 156..179 CDD:275380 5/22 (23%)
leucine-rich repeat 180..203 CDD:275380 10/22 (45%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
leucine-rich repeat 228..251 CDD:275380 9/48 (19%)
leucine-rich repeat 252..275 CDD:275380 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.