DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and zgc:153913

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_001073448.1 Gene:zgc:153913 / 559700 ZFINID:ZDB-GENE-061103-397 Length:496 Species:Danio rerio


Alignment Length:496 Identity:116/496 - (23%)
Similarity:217/496 - (43%) Gaps:84/496 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   499 ELRSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLSGCNIRQISG 563
            ::|.|.:..:.:.:|....|.|...:..|......|..::|..|:.|..|:.:::|| ||..:|.
Zfish    50 QVRELIVVASGIPDLDQQSFPETLRLSKLVFLNGMLKSVSGEAFERLVELRELEISG-NICWMSL 113

  Fly   564 DLLAGLQDLKHIYLNDNQLQELQDGSFVNLWNISSIDLSNNRIGSIRSGAFVNVMKLQKLDLHGN 628
            |:                      .:|.:|.|::.:.|:||::..:.:|.|.::.:|:.|.|.||
Zfish   114 DI----------------------QTFSSLTNLTRLLLNNNKLSGVDAGLFHSLHQLEMLQLRGN 156

  Fly   629 QLSAFKGEYFNTGTGIEELDISDNQLSYLFPSSFRIHPRLREIRAANNKFSFFPAELISTLQYLE 693
            .||...|..|.....::|||:|.||:|.|....|:.:..||.:....||....|..:.:.|.:|:
Zfish   157 GLSFLSGRLFQRLHRLQELDLSFNQISSLSTELFQNNSELRVLSLQANKIPNLPDGIFTHLDHLQ 221

  Fly   694 HIDLSHNQLKTIEELDFARLPRLRVLLVANNQLDMVSEMAFHNSTQLQILDLAHNNLDRIGERTF 758
            .::|..|.::.:....|.  ..|:.|::..|.|:.::...||....:..|||:.|:|..:....|
Zfish   222 ELNLRSNLIRVLTPGSFP--ASLKTLILKKNLLEKLTNAVFHTLHYITYLDLSQNSLTEVPADLF 284

  Fly   759 EGLVRLEQLNLEGNRLSELSDGVFERTKLQMLENINLAHNRFEYAPLNALQRQFFFVSSVDLSHN 823
            :.|:.||.|:|..||:|.|:..||:  .|..::::.|..|.......:.|:.| ..:..:|||:|
Zfish   285 QNLISLETLDLSENRISTLAGSVFK--GLFSIKSVYLQKNSLISVDAHLLKDQ-HDLQLLDLSNN 346

  Fly   824 KIKELPGDDSIMVNIKRIDLSFNPLSSKAVHNVLNEPKTVRELSLAGTGIENLELLETPFLQFLN 888
            .::.:|..            .|..|..:.|..:...|.:      ...||..       |..:|.
Zfish   347 SLRSIPSG------------FFEDLDFQCVFELRGNPWS------CDCGIHY-------FYDWLK 386

  Fly   889 LSHNKLKNVK------PEVFQRVTLLETLDLSSNQLESLEDLSMAWPQLQVLQSLDVSNNSFEIV 947
            .:|..:|::.      ||:.|           .:.|.|::       :.|::.|.:.|:||.|::
Zfish   387 YNHKHVKDLSRVSCEAPELIQ-----------GHNLRSVD-------REQLVCSRNSSSNSPEMI 433

  Fly   948 S------QSNFGKLEMLRSLRLSHLPQCTRIEKNAFKQLPN 982
            |      |.:..:|:...|:... :.:||.::..|..|..|
Zfish   434 SVDEGSIQCSVQELKGTASIECK-VTKCTNVKFQAAFQFAN 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..257 CDD:275380
PLN00113 237..>750 CDD:215061 63/250 (25%)
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..329 CDD:275380
leucine-rich repeat 330..353 CDD:275380
leucine-rich repeat 354..377 CDD:275380
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 428..451 CDD:275380
leucine-rich repeat 452..473 CDD:275380
leucine-rich repeat 477..497 CDD:275378
leucine-rich repeat 500..523 CDD:275380 5/22 (23%)
leucine-rich repeat 524..547 CDD:275380 5/22 (23%)
leucine-rich repeat 548..571 CDD:275380 7/22 (32%)
leucine-rich repeat 572..595 CDD:275380 2/22 (9%)
leucine-rich repeat 596..619 CDD:275380 5/22 (23%)
leucine-rich repeat 620..643 CDD:275380 9/22 (41%)
leucine-rich repeat 644..667 CDD:275380 9/22 (41%)
leucine-rich repeat 668..691 CDD:275380 6/22 (27%)
LRR <684..1020 CDD:443914 68/311 (22%)
leucine-rich repeat 692..715 CDD:275380 4/22 (18%)
leucine-rich repeat 716..739 CDD:275380 6/22 (27%)
leucine-rich repeat 740..761 CDD:275380 6/20 (30%)
leucine-rich repeat 764..789 CDD:275380 11/24 (46%)
leucine-rich repeat 790..810 CDD:275380 3/19 (16%)
leucine-rich repeat 818..850 CDD:275380 7/31 (23%)
leucine-rich repeat 863..883 CDD:275378 2/19 (11%)
leucine-rich repeat 884..907 CDD:275380 6/28 (21%)
leucine-rich repeat 908..933 CDD:275380 2/24 (8%)
leucine-rich repeat 934..955 CDD:275380 7/26 (27%)
leucine-rich repeat 958..982 CDD:275380 5/23 (22%)
leucine-rich repeat 983..1055 CDD:275380 116/496 (23%)
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
zgc:153913NP_001073448.1 leucine-rich repeat 75..98 CDD:275380 5/22 (23%)
LRR <142..>352 CDD:443914 61/214 (29%)
leucine-rich repeat 148..171 CDD:275380 9/22 (41%)
leucine-rich repeat 172..195 CDD:275380 9/22 (41%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
leucine-rich repeat 220..241 CDD:275380 4/22 (18%)
leucine-rich repeat 242..265 CDD:275380 6/22 (27%)
leucine-rich repeat 266..289 CDD:275380 7/22 (32%)
leucine-rich repeat 290..313 CDD:275380 11/24 (46%)
leucine-rich repeat 314..337 CDD:275380 4/23 (17%)
leucine-rich repeat 338..359 CDD:275380 6/32 (19%)
PCC 342..>427 CDD:188093 22/127 (17%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.