DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and lrrc4ba

DIOPT Version :9

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:XP_021329717.1 Gene:lrrc4ba / 556747 ZFINID:ZDB-GENE-080327-25 Length:729 Species:Danio rerio


Alignment Length:376 Identity:96/376 - (25%)
Similarity:143/376 - (38%) Gaps:132/376 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 RNSLTSVPTNSLNGPSALRHLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRSIDSLAFKGLQK 257
            |..|..||.|..|.   .|:|:|::|.|..:.:|:|...|.|||:.|..|.||.|:..||.||..
Zfish    57 RQHLEEVPDNISNN---TRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPN 118

  Fly   258 IREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVALAAVPGLKHLNLSSNMLQQLDYT 322
            :..::|..||::.:.|..||.|..|::|.|..|.....|..|...||.|:.|:|..  |::||| 
Zfish   119 LNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGE--LKKLDY- 180

  Fly   323 HMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIEDDALEGLDSLQTLIIKDNN 387
                                |:...|..:..|:||:|.:..|:.|                    
Zfish   181 --------------------ISDAAFVGLINLRYLNLGMCGLKDI-------------------- 205

  Fly   388 ILLVPGSALGRLPQLTSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSL 452
                        |.||.|                                :|            |
Zfish   206 ------------PNLTPL--------------------------------VR------------L 214

  Fly   453 HTLDLSGNSLAVINADTFAGLESTLMALKLSQNRLTGLGGAPWVLPELRSLDLSGNTLTELPSTI 517
            ..|:||||.|.:|...:|.||||                        ||.|.|..:.::.:....
Zfish   215 EELELSGNRLEIIRPGSFQGLES------------------------LRKLWLMHSQMSVIERNA 255

  Fly   518 FEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLS------GCNIRQIS 562
            |::|:|::.||||.|.|..|...||.||.:|:.:.|:      .|::..:|
Zfish   256 FDDLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 LRR_8 109..172 CDD:290566
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064 48/144 (33%)
leucine-rich repeat 133..161 CDD:275380
LRR_8 160..220 CDD:290566 10/26 (38%)
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380 6/15 (40%)
leucine-rich repeat 210..233 CDD:275380 7/22 (32%)
LRR_8 232..290 CDD:290566 23/57 (40%)
leucine-rich repeat 234..257 CDD:275380 12/22 (55%)
leucine-rich repeat 258..281 CDD:275380 7/22 (32%)
LRR_RI 273..535 CDD:238064 57/261 (22%)
LRR_8 281..338 CDD:290566 15/56 (27%)
leucine-rich repeat 282..329 CDD:275380 15/46 (33%)
LRR_8 328..388 CDD:290566 8/59 (14%)
leucine-rich repeat 330..353 CDD:275380 2/22 (9%)
leucine-rich repeat 354..377 CDD:275380 6/22 (27%)
leucine-rich repeat 378..401 CDD:275380 0/22 (0%)
leucine-rich repeat 402..425 CDD:275380 3/22 (14%)
leucine-rich repeat 428..451 CDD:275380 1/22 (5%)
LRR_8 429..487 CDD:290566 14/57 (25%)
leucine-rich repeat 452..473 CDD:275380 9/20 (45%)
leucine-rich repeat 477..497 CDD:275378 0/19 (0%)
LRR_8 498..558 CDD:290566 21/65 (32%)
leucine-rich repeat 500..523 CDD:275380 6/22 (27%)
LRR_RI 502..769 CDD:238064 20/67 (30%)
leucine-rich repeat 524..547 CDD:275380 11/22 (50%)
leucine-rich repeat 548..571 CDD:275380 4/21 (19%)
LRR_8 572..630 CDD:290566
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
LRR_8 619..678 CDD:290566
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
LRR_8 666..726 CDD:290566
leucine-rich repeat 668..691 CDD:275380
leucine-rich repeat 692..715 CDD:275380
LRR_8 714..774 CDD:290566
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
LRR_RI <878..1070 CDD:238064
LRR_8 884..944 CDD:290566
LRR_4 884..925 CDD:289563
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
TPKR_C2 1121..1168 CDD:301599
lrrc4baXP_021329717.1 LRR <60..280 CDD:227223 87/345 (25%)
leucine-rich repeat 71..94 CDD:275380 7/22 (32%)
leucine-rich repeat 95..118 CDD:275380 12/22 (55%)
leucine-rich repeat 119..142 CDD:275380 7/22 (32%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
leucine-rich repeat 167..191 CDD:275380 9/46 (20%)
leucine-rich repeat 192..213 CDD:275380 10/84 (12%)
leucine-rich repeat 214..237 CDD:275380 11/22 (50%)
leucine-rich repeat 238..261 CDD:275380 6/22 (27%)
leucine-rich repeat 262..283 CDD:275380 9/20 (45%)
TPKR_C2 294..344 CDD:326558 2/13 (15%)
I-set 347..436 CDD:333254
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.