DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and cDIP

DIOPT Version :9

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_650951.1 Gene:cDIP / 42512 FlyBaseID:FBgn0038865 Length:554 Species:Drosophila melanogaster


Alignment Length:468 Identity:112/468 - (23%)
Similarity:180/468 - (38%) Gaps:144/468 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   501 RSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFKPLDRLQVIDLSGCNIRQISGDL 565
            |:|.....|.|..|..:|..||                         :..:|:.||.||.|..:.
  Fly    96 RTLIFENCTFTNFPLRLFYTLE-------------------------VSELDMRGCGIRFIYWEN 135

  Fly   566 LA-GLQDLKHIYLNDNQLQELQDGSFVNLWNISSIDLSNNRIGSIRSGAFVNVMKLQKLDLHGNQ 629
            .: |...|..:.|:||.::.|...:|....|:..|.|:.|::|.:::|||.|::|||.|||..|:
  Fly   136 FSIGADKLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLGKLQAGAFDNLLKLQYLDLTENR 200

  Fly   630 LSAFKGEYFNTGTGIEELDISDNQLSYLFPSSFRIHPRLREIRAANNKFSFFPAELISTLQYLEH 694
            |.|                                                ..|::.:.|:.|.|
  Fly   201 LEA------------------------------------------------LAADVFAGLKSLRH 217

  Fly   695 IDLSHNQLKTIEELDFARLPRLRVLLVANNQLDMVSEMAFHN---STQLQILDLAHNNLDRIGER 756
            :.|:.|||.|||...||..|.|..:.:.||:|..|.|.||.:   ..|:|.:||::|.       
  Fly   218 VGLAGNQLTTIESDLFAHNPDLLSVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNNP------- 275

  Fly   757 TFEGLVRLEQLNLEGNRLSELSDGVFERTKLQMLENINLAHNRFEYAPLNALQRQFFFVSSVDLS 821
              |.:|.|  ||:....|:         .:...|:.:||                :..|::||||
  Fly   276 --ELVVLL--LNINATNLT---------ARNCSLDRVNL----------------YGSVTNVDLS 311

  Fly   822 HNKIKELPGDDSIMVNIKRIDLSFNPLSSKAVHNVLNEPKTVRELSLAGT-GIENLELLE----- 880
            .|:::||                :.|.|....|.||.....|:..||:.. .:.:|::.:     
  Fly   312 DNRVREL----------------YFPASEALEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLG 360

  Fly   881 -------TPFLQFLNLSHNKLKNVKPEVFQRVTLLETLDLSSNQLESLEDLSMAWPQLQVLQSLD 938
                   ||.|:.|.|.:.....:..|..|.:..|:.||:|.|.|..::  ..|:|.|..|....
  Fly   361 QLPDGWRTPHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEID--PSAFPTLTQLTHFY 423

  Fly   939 VSNNSFEIVSQSN 951
            :..|::...|..|
  Fly   424 IHGNNWNCFSLRN 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 LRR_8 109..172 CDD:290566
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064
leucine-rich repeat 133..161 CDD:275380
LRR_8 160..220 CDD:290566
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
LRR_8 232..290 CDD:290566
leucine-rich repeat 234..257 CDD:275380
leucine-rich repeat 258..281 CDD:275380
LRR_RI 273..535 CDD:238064 8/33 (24%)
LRR_8 281..338 CDD:290566
leucine-rich repeat 282..329 CDD:275380
LRR_8 328..388 CDD:290566
leucine-rich repeat 330..353 CDD:275380
leucine-rich repeat 354..377 CDD:275380
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 428..451 CDD:275380
LRR_8 429..487 CDD:290566
leucine-rich repeat 452..473 CDD:275380
leucine-rich repeat 477..497 CDD:275378
LRR_8 498..558 CDD:290566 11/56 (20%)
leucine-rich repeat 500..523 CDD:275380 7/21 (33%)
LRR_RI 502..769 CDD:238064 69/270 (26%)
leucine-rich repeat 524..547 CDD:275380 0/22 (0%)
leucine-rich repeat 548..571 CDD:275380 7/23 (30%)
LRR_8 572..630 CDD:290566 22/57 (39%)
leucine-rich repeat 572..595 CDD:275380 6/22 (27%)
leucine-rich repeat 596..619 CDD:275380 8/22 (36%)
LRR_8 619..678 CDD:290566 9/58 (16%)
leucine-rich repeat 620..643 CDD:275380 8/22 (36%)
leucine-rich repeat 644..667 CDD:275380 0/22 (0%)
LRR_8 666..726 CDD:290566 17/59 (29%)
leucine-rich repeat 668..691 CDD:275380 2/22 (9%)
leucine-rich repeat 692..715 CDD:275380 11/22 (50%)
LRR_8 714..774 CDD:290566 19/62 (31%)
leucine-rich repeat 716..739 CDD:275380 8/25 (32%)
leucine-rich repeat 740..761 CDD:275380 5/20 (25%)
leucine-rich repeat 764..789 CDD:275380 4/24 (17%)
leucine-rich repeat 790..810 CDD:275380 3/19 (16%)
leucine-rich repeat 818..850 CDD:275380 8/31 (26%)
leucine-rich repeat 863..883 CDD:275378 5/32 (16%)
LRR_RI <878..1070 CDD:238064 20/86 (23%)
LRR_8 884..944 CDD:290566 16/59 (27%)
LRR_4 884..925 CDD:289563 11/40 (28%)
leucine-rich repeat 884..907 CDD:275380 5/22 (23%)
leucine-rich repeat 908..933 CDD:275380 9/24 (38%)
leucine-rich repeat 934..955 CDD:275380 4/18 (22%)
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
TPKR_C2 1121..1168 CDD:301599
cDIPNP_650951.1 leucine-rich repeat 118..142 CDD:275380 7/23 (30%)
LRR_RI 143..407 CDD:238064 90/363 (25%)
leucine-rich repeat 143..166 CDD:275380 6/22 (27%)
LRR_8 166..225 CDD:290566 24/106 (23%)
leucine-rich repeat 167..190 CDD:275380 8/22 (36%)
leucine-rich repeat 191..214 CDD:275380 10/70 (14%)
leucine-rich repeat 215..238 CDD:275380 11/22 (50%)
leucine-rich repeat 239..265 CDD:275380 8/25 (32%)
leucine-rich repeat 266..325 CDD:275380 23/110 (21%)
LRR_8 304..357 CDD:290566 17/68 (25%)
leucine-rich repeat 326..347 CDD:275380 6/20 (30%)
leucine-rich repeat 348..394 CDD:275380 8/45 (18%)
LRR_8 369..428 CDD:290566 16/60 (27%)
LRR_4 393..433 CDD:289563 11/41 (27%)
leucine-rich repeat 395..418 CDD:275380 9/24 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.