DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and CG42709

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_648600.1 Gene:CG42709 / 39453 FlyBaseID:FBgn0261674 Length:458 Species:Drosophila melanogaster


Alignment Length:251 Identity:68/251 - (27%)
Similarity:109/251 - (43%) Gaps:41/251 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 LIEEGLLKGCMDLKEFYIDRNS---LTSVPTNSLNGPSALRHLSLRQNQIGSLLADSF-NAQRQL 234
            ::|....:.|:.|::|...:.:   ||.||   |:.|.....:.|..|.|..|..:.| |..|.:
  Fly    88 VLEPSCPRNCLCLEDFKFVQCANAHLTHVP---LDMPKTAAIIDLSHNVIAELRPEDFANLSRAV 149

  Fly   235 EIIDLRHNVIRSIDSLAFKGLQKIREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVA 299
            | |:|.||:|.|||...|:|.::::.::||.||::.::.|.|...:.|..||||.|...|     
  Fly   150 E-INLNHNLISSIDKDVFQGSERLKRLRLANNRLTKIDPDTFAAAKELTLLDLSNNTITQ----- 208

  Fly   300 LAAVPGLKHLNLSSNMLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSL 364
                      .|..:.|.|.|......|..         :.|.:...||:.|..|:.|.|:.|..
  Fly   209 ----------RLDGSFLNQPDLVEFSCVNC---------SWTELPEQTFQNMSGLEVLRLNKNDF 254

  Fly   365 R-TIEDDALEGLDSLQTLIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSAEI 419
            : .|...|...|    |.|||    |.:|......:.:|.||....:.::.|:.:|
  Fly   255 KQQINTKAFSPL----TKIIK----LKLPELEQQNIEELCSLLTSIDTISFLNYDI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268 66/240 (28%)
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380 2/10 (20%)
leucine-rich repeat 186..209 CDD:275380 8/25 (32%)
leucine-rich repeat 210..233 CDD:275380 6/23 (26%)
leucine-rich repeat 234..257 CDD:275380 11/22 (50%)
PLN00113 237..>750 CDD:215061 50/184 (27%)
leucine-rich repeat 258..281 CDD:275380 6/22 (27%)
leucine-rich repeat 282..329 CDD:275380 12/46 (26%)
leucine-rich repeat 330..353 CDD:275380 4/22 (18%)
leucine-rich repeat 354..377 CDD:275380 7/23 (30%)
leucine-rich repeat 378..401 CDD:275380 6/22 (27%)
leucine-rich repeat 402..425 CDD:275380 5/18 (28%)
leucine-rich repeat 428..451 CDD:275380
leucine-rich repeat 452..473 CDD:275380
leucine-rich repeat 477..497 CDD:275378
leucine-rich repeat 500..523 CDD:275380
leucine-rich repeat 524..547 CDD:275380
leucine-rich repeat 548..571 CDD:275380
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
leucine-rich repeat 668..691 CDD:275380
LRR <684..1020 CDD:443914
leucine-rich repeat 692..715 CDD:275380
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
CG42709NP_648600.1 LRR <127..>300 CDD:443914 57/205 (28%)
leucine-rich repeat 128..147 CDD:275380 6/18 (33%)
leucine-rich repeat 148..171 CDD:275380 11/23 (48%)
leucine-rich repeat 172..195 CDD:275380 6/22 (27%)
leucine-rich repeat 196..219 CDD:275380 10/37 (27%)
leucine-rich repeat 220..243 CDD:275380 5/31 (16%)
leucine-rich repeat 244..268 CDD:275380 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.