DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and Lapsyn

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_611561.1 Gene:Lapsyn / 37418 FlyBaseID:FBgn0034602 Length:343 Species:Drosophila melanogaster


Alignment Length:283 Identity:72/283 - (25%)
Similarity:109/283 - (38%) Gaps:88/283 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   428 ITTLSLSRNVIRELPPGSFQMFSSLHTLDLSGNSLAVINADTFAGLESTLMALKLSQNRLTGLGG 492
            :..|.||.|.||:|...|||.::.:..|.|..|.:..:...||..|.|                 
  Fly    60 VEVLDLSHNRIRKLKTSSFQRYTDIKFLMLYDNMILSVEVGTFEPLTS----------------- 107

  Fly   493 APWVLPELRSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLT-GALFKPLDR-LQVIDLSG 555
                   |:.:|||.|.||.:|..:| :|..:::|.:..|.||.|. .||.||:.. |:.::::|
  Fly   108 -------LQEIDLSNNGLTTIPLELF-QLPRLRNLYIDSNELTSLNLQALEKPIRAPLEYLNVAG 164

  Fly   556 CNIRQISGDLLAGLQDLKHIYLNDNQLQELQD-GSFVNLWNISSIDLSNNRIGSIRSGAFVNVMK 619
            |                        :||||.| |....||.:::   |.|.:.:.|..:..|:..
  Fly   165 C------------------------ELQELPDLGILPKLWQLNA---SMNPLQNFRIDSLANMCH 202

  Fly   620 LQKLDLHGNQLS-----AFKGEYFNTGTG-------IEELDISDNQLSYLFPSSFRIHPRLREIR 672
            ||.:||..:|||     .........|..       :|.|||.:..|.|                
  Fly   203 LQVIDLTKSQLSQCGCQQVTNHLMMLGASPKFVPVCLEALDIRECPLPY---------------- 251

  Fly   673 AANNKFSFFP--AELISTLQYLE 693
               |:....|  |...:|||:.|
  Fly   252 ---NRTIHSPTFASCQTTLQFAE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..257 CDD:275380
PLN00113 237..>750 CDD:215061 72/283 (25%)
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..329 CDD:275380
leucine-rich repeat 330..353 CDD:275380
leucine-rich repeat 354..377 CDD:275380
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 428..451 CDD:275380 10/22 (45%)
leucine-rich repeat 452..473 CDD:275380 5/20 (25%)
leucine-rich repeat 477..497 CDD:275378 0/19 (0%)
leucine-rich repeat 500..523 CDD:275380 10/22 (45%)
leucine-rich repeat 524..547 CDD:275380 9/23 (39%)
leucine-rich repeat 548..571 CDD:275380 3/22 (14%)
leucine-rich repeat 572..595 CDD:275380 7/23 (30%)
leucine-rich repeat 596..619 CDD:275380 4/22 (18%)
leucine-rich repeat 620..643 CDD:275380 8/27 (30%)
leucine-rich repeat 644..667 CDD:275380 6/22 (27%)
leucine-rich repeat 668..691 CDD:275380 5/24 (21%)
LRR <684..1020 CDD:443914 4/10 (40%)
leucine-rich repeat 692..715 CDD:275380 1/2 (50%)
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
LapsynNP_611561.1 LRR <34..>214 CDD:443914 56/205 (27%)
leucine-rich repeat 39..59 CDD:275380
leucine-rich repeat 60..83 CDD:275380 10/22 (45%)
leucine-rich repeat 84..107 CDD:275380 6/22 (27%)
leucine-rich repeat 108..130 CDD:275380 10/22 (45%)
leucine-rich repeat 131..154 CDD:275380 9/22 (41%)
leucine-rich repeat 157..178 CDD:275380 9/44 (20%)
leucine-rich repeat 179..202 CDD:275380 6/25 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.