DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and Tril

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_001029182.1 Gene:Tril / 362364 RGDID:1310827 Length:811 Species:Rattus norvegicus


Alignment Length:479 Identity:130/479 - (27%)
Similarity:185/479 - (38%) Gaps:142/479 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 CMDLKEFYIDRNSLTSVP-TNSLNGPSALRHLSLRQNQIGSLLADSFNAQRQLEIIDLRHNVIRS 246
            |...:........|.:|| |:||..|..:...||..|.|.::.|..|:...||..:||::|.|||
  Rat    33 CQHPQHLLCTNRGLRAVPKTSSLPSPQDVLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRS 97

  Fly   247 IDSLAFKGLQKIREIKLA------------------------GNRISHLNSDVFEKLQSLQKLDL 287
            :....|:.|.::.|:.|.                        ||.|..|:...||.|:||.||.|
  Rat    98 LHPKTFEKLSRLEELYLGNNLLQALAPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRL 162

  Fly   288 SENFFGQFPTVALAAVPGLKHLNLSSNMLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMG 352
            ..|..|..|....|.:..|.:|:|.:|.::.|                .:|        .|.::|
  Rat   163 DGNVLGALPDAVFAPLGNLLYLHLEANRIRFL----------------GKN--------AFTQLG 203

  Fly   353 ALKYLDLSLNSLRTIEDDALEGLDSLQTLIIKDNNILLVPGSALGRLPQLTSLQLDYNRVAALSA 417
            .|::|:||.|.|:                                  |.|        |.||...
  Rat   204 KLRFLNLSANELQ----------------------------------PSL--------RHAATFV 226

  Fly   418 EILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLSGNSLAVINADTFAGLESTLMALKL 482
            .:      ..::||.||.|.::.|.|..||....|..|.||||.|..:..:.|.|||: |..|:|
  Rat   227 PL------RSLSTLILSANSLQHLGPRVFQHLPRLGLLSLSGNQLTHLAPEAFWGLEA-LRELRL 284

  Fly   483 SQNRLTGLGGAPWVLPE----LRSLDLSGNTLTELPSTIFEELENVQSLNLSGNHLTPLTGALFK 543
            ..|||..|   |..|.|    |.:||||||.|:.|....|.....::.|:|..|.|:.|:|.:|.
  Rat   285 EGNRLNQL---PLTLLEPLHSLEALDLSGNELSALHPATFGHQGRLRELSLRDNALSALSGDIFA 346

  Fly   544 PLDRLQVIDLSG------CNIRQI---------SGDLLAGLQDLKH---------IYLNDNQLQE 584
            ....|..:||.|      |.:|.:         .|.||......:|         .||:|   |.
  Rat   347 ASPALYRLDLDGNGWTCDCRLRGLKRWMGNWHSQGRLLTVFVQCRHPPALRGKYLDYLDD---QL 408

  Fly   585 LQDGSFVN----------LWNISS 598
            ||:||.|:          .|.||:
  Rat   409 LQNGSCVDPSPSPTAGSRQWPIST 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268 58/251 (23%)
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380 1/1 (100%)
leucine-rich repeat 186..209 CDD:275380 7/23 (30%)
leucine-rich repeat 210..233 CDD:275380 6/22 (27%)
leucine-rich repeat 234..257 CDD:275380 9/22 (41%)
PLN00113 237..>750 CDD:215061 114/424 (27%)
leucine-rich repeat 258..281 CDD:275380 9/46 (20%)
leucine-rich repeat 282..329 CDD:275380 13/46 (28%)
leucine-rich repeat 330..353 CDD:275380 2/22 (9%)
leucine-rich repeat 354..377 CDD:275380 6/22 (27%)
leucine-rich repeat 378..401 CDD:275380 0/22 (0%)
leucine-rich repeat 402..425 CDD:275380 4/22 (18%)
leucine-rich repeat 428..451 CDD:275380 9/22 (41%)
leucine-rich repeat 452..473 CDD:275380 8/20 (40%)
leucine-rich repeat 477..497 CDD:275378 8/19 (42%)
leucine-rich repeat 500..523 CDD:275380 10/22 (45%)
leucine-rich repeat 524..547 CDD:275380 7/22 (32%)
leucine-rich repeat 548..571 CDD:275380 9/37 (24%)
leucine-rich repeat 572..595 CDD:275380 10/41 (24%)
leucine-rich repeat 596..619 CDD:275380 2/3 (67%)
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
leucine-rich repeat 668..691 CDD:275380
LRR <684..1020 CDD:443914
leucine-rich repeat 692..715 CDD:275380
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
TrilNP_001029182.1 LRRNT 27..56 CDD:214470 6/22 (27%)
leucine-rich repeat 37..57 CDD:275378 6/19 (32%)
LRR 1 61..81 6/19 (32%)
LRR_8 65..119 CDD:404697 18/53 (34%)
LRR 2 84..105 9/20 (45%)
leucine-rich repeat 85..108 CDD:275380 9/22 (41%)
LRR 104..>359 CDD:443914 88/330 (27%)
LRR 3 108..129 2/20 (10%)
leucine-rich repeat 109..132 CDD:275380 2/22 (9%)
LRR 4 132..153 5/20 (25%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
LRR 5 156..177 8/20 (40%)
leucine-rich repeat 157..180 CDD:275380 8/22 (36%)
LRR 6 180..201 7/44 (16%)
leucine-rich repeat 181..204 CDD:275380 7/46 (15%)
LRR 7 204..223 9/60 (15%)
leucine-rich repeat 205..230 CDD:275380 11/72 (15%)
LRR 8 230..251 8/20 (40%)
leucine-rich repeat 231..254 CDD:275380 9/22 (41%)
LRR 9 254..275 8/20 (40%)
leucine-rich repeat 255..278 CDD:275380 10/22 (45%)
LRR 10 278..298 9/23 (39%)
leucine-rich repeat 279..302 CDD:275380 10/25 (40%)
LRR 11 302..323 10/20 (50%)
leucine-rich repeat 303..323 CDD:275380 10/19 (53%)
LRR 12 326..347 7/20 (35%)
leucine-rich repeat 327..340 CDD:275378 4/12 (33%)
PCC 332..>441 CDD:188093 28/104 (27%)
leucine-rich repeat 351..363 CDD:275378 4/11 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 414..460 4/19 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 486..562
FN3 589..667 CDD:473895
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.