DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and CG18480

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_609761.1 Gene:CG18480 / 34920 FlyBaseID:FBgn0028518 Length:550 Species:Drosophila melanogaster


Alignment Length:270 Identity:71/270 - (26%)
Similarity:114/270 - (42%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   692 LEHIDLSHNQLKTIEELDFARLPRLRVLLVANNQLDMVSEMAFHNSTQLQILDLAHNNLDRIGER 756
            :|.:|||:|.:.||::..|.....|..|.:|:|.:..:...||...|:|:.|||::|.|::|.|.
  Fly    76 VELLDLSYNDITTIDDDSFKTTIHLLNLTLAHNAIHTLYGDAFVELTRLRYLDLSYNRLEQIDEH 140

  Fly   757 TFEGLVRLEQLNLEGNRLSELSDGVFERTKLQMLENINLAH---NRFEYAPLNALQRQFFFVSSV 818
            ..|...:|..||||||:||.|..|...|:  ..|.::||.:   |:.....|:||.:    :..:
  Fly   141 ILESNNQLIHLNLEGNKLSTLGKGPILRS--PSLRSLNLRNSQVNQLGTQLLSALPQ----LRQL 199

  Fly   819 DLSHNKIKEL-PGDDSIMVNIKRIDLSFNPLSSKAVHNVLNEPKTVRELSLAGTGIENLELL--- 879
            ||:.|.:..| |||.....|:..:::..||.:..            |.|:...||:....:.   
  Fly   200 DLAQNLLLTLSPGDFHAPRNLASLNVEENPFNCD------------RALAKVATGLRQRGVAIFM 252

  Fly   880 -------------ETPFLQFLNLSHNKLKNVKPEVFQRVTLLE--------------TLDLSSNQ 917
                         :...:.|.|         |.|.|:.:..||              .||.|..|
  Fly   253 SNCMEEEVQDHQDDAEAVNFPN---------KNEKFESMEYLEPSTRGPQSVLSVWRDLDSSEEQ 308

  Fly   918 LESLEDLSMA 927
            ..|.:|..|:
  Fly   309 NSSQDDEQMS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..257 CDD:275380
PLN00113 237..>750 CDD:215061 20/57 (35%)
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..329 CDD:275380
leucine-rich repeat 330..353 CDD:275380
leucine-rich repeat 354..377 CDD:275380
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 428..451 CDD:275380
leucine-rich repeat 452..473 CDD:275380
leucine-rich repeat 477..497 CDD:275378
leucine-rich repeat 500..523 CDD:275380
leucine-rich repeat 524..547 CDD:275380
leucine-rich repeat 548..571 CDD:275380
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
leucine-rich repeat 668..691 CDD:275380
LRR <684..1020 CDD:443914 71/270 (26%)
leucine-rich repeat 692..715 CDD:275380 8/22 (36%)
leucine-rich repeat 716..739 CDD:275380 6/22 (27%)
leucine-rich repeat 740..761 CDD:275380 9/20 (45%)
leucine-rich repeat 764..789 CDD:275380 12/24 (50%)
leucine-rich repeat 790..810 CDD:275380 7/22 (32%)
leucine-rich repeat 818..850 CDD:275380 10/32 (31%)
leucine-rich repeat 863..883 CDD:275378 4/35 (11%)
leucine-rich repeat 884..907 CDD:275380 5/22 (23%)
leucine-rich repeat 908..933 CDD:275380 9/34 (26%)
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
CG18480NP_609761.1 LRR <66..>230 CDD:443914 52/159 (33%)
leucine-rich repeat 76..99 CDD:275380 8/22 (36%)
leucine-rich repeat 100..123 CDD:275380 6/22 (27%)
leucine-rich repeat 124..147 CDD:275380 9/22 (41%)
leucine-rich repeat 148..171 CDD:275380 12/24 (50%)
leucine-rich repeat 172..195 CDD:275380 7/22 (32%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.