DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7896 and kek1

DIOPT Version :10

Sequence 1:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster
Sequence 2:NP_523559.3 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster


Alignment Length:178 Identity:58/178 - (32%)
Similarity:77/178 - (43%) Gaps:24/178 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   621 QKLDLHGNQLSAFKGEYFNTGTGIEELDISDNQLSYLFPSSFRIHPRLREIRAANNKFSFFPAEL 685
            |.||:.||:|.....|.|          |..|.|:            |:::...|.|......|.
  Fly   124 QVLDMSGNKLQTLSNEQF----------IRANLLN------------LQKLYLRNCKIGEIERET 166

  Fly   686 ISTLQYLEHIDLSHNQLKTIEELDFARLPRLRVLLVANNQLDMVSEMAFHNSTQLQILDLAHNNL 750
            ...|..|..:|||||.|.|:..|....:|.||.|.:|:|.:..:...||.|:..|..|||:|.::
  Fly   167 FKGLTNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDI 231

  Fly   751 DRIGERTFEGLVRLEQLNLEGNRLSELSDGVFERTKLQMLENINLAHN 798
            ..|..:.|.||..|..|.|.||:||||.....|  .|..|..|.|..|
  Fly   232 QTISAQAFGGLQGLTLLRLNGNKLSELLPKTIE--TLSRLHGIELHDN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7896NP_651754.1 PRK15370 20..>410 CDD:185268
leucine-rich repeat 109..132 CDD:275380
leucine-rich repeat 133..161 CDD:275380
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
leucine-rich repeat 234..257 CDD:275380
PLN00113 237..>750 CDD:215061 39/128 (30%)
leucine-rich repeat 258..281 CDD:275380
leucine-rich repeat 282..329 CDD:275380
leucine-rich repeat 330..353 CDD:275380
leucine-rich repeat 354..377 CDD:275380
leucine-rich repeat 378..401 CDD:275380
leucine-rich repeat 402..425 CDD:275380
leucine-rich repeat 428..451 CDD:275380
leucine-rich repeat 452..473 CDD:275380
leucine-rich repeat 477..497 CDD:275378
leucine-rich repeat 500..523 CDD:275380
leucine-rich repeat 524..547 CDD:275380
leucine-rich repeat 548..571 CDD:275380
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
leucine-rich repeat 620..643 CDD:275380 8/21 (38%)
leucine-rich repeat 644..667 CDD:275380 3/22 (14%)
leucine-rich repeat 668..691 CDD:275380 5/22 (23%)
LRR <684..1020 CDD:443914 44/115 (38%)
leucine-rich repeat 692..715 CDD:275380 9/22 (41%)
leucine-rich repeat 716..739 CDD:275380 8/22 (36%)
leucine-rich repeat 740..761 CDD:275380 7/20 (35%)
leucine-rich repeat 764..789 CDD:275380 11/24 (46%)
leucine-rich repeat 790..810 CDD:275380 4/9 (44%)
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
LRRCT 1121..1168 CDD:214507
kek1NP_523559.3 leucine-rich repeat 103..122 CDD:275380
LRR <122..>277 CDD:443914 57/176 (32%)
leucine-rich repeat 123..148 CDD:275380 10/33 (30%)
leucine-rich repeat 149..172 CDD:275380 5/22 (23%)
leucine-rich repeat 173..196 CDD:275380 9/22 (41%)
leucine-rich repeat 197..220 CDD:275380 8/22 (36%)
leucine-rich repeat 221..244 CDD:275380 9/22 (41%)
leucine-rich repeat 245..268 CDD:275380 11/24 (46%)
LRRCT 277..327 CDD:214507 1/1 (100%)
IG_like 338..429 CDD:214653
Ig strand B 346..350 CDD:409353
Ig strand C 359..363 CDD:409353
Ig strand E 395..399 CDD:409353
Ig strand F 409..414 CDD:409353
Ig strand G 422..425 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.